KEGG   Arabidopsis thaliana (thale cress): AT1G26260Help
Entry
AT1G26260         CDS       T00041                                 

Gene name
CIB5
Definition
(RefSeq) cryptochrome-interacting basic-helix-loop-helix 5
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 839167
NCBI-ProteinID: NP_001323071
MIPS: AT1G26260.1
TAIR: AT1G26260
Araport: AT1G26260
UniProt: Q9C670 A0A178WLZ9
Position
1
AA seq 390 aa AA seqDB search
MSDKDEFAAKKKDLVNTPVDLYPPENPMLGPSPMMDSFRETLWHDGGFNVHTDADTSFRG
NNNIDIPLEMGWNMAQFPADSGFIERAAKFSFFGCGEMMMNQQQSSLGVPDSTGLFLQDT
QIPSGSKLDNGPLTDASKLVKERSINNVSEDSQSSGGNGHDDAKCGQTSSKGFSSKKRKR
IGKDCEEEEDKKQKDEQSPTSNANKTNSEKQPSDSLKDGYIHMRARRGQATNSHSLAERV
RREKISERMKFLQDLVPGCDKVTGKAVMLDEIINYVQSLQCQIEFLSMKLSAVNPVLDFN
LESLLAKDALQSSAPTFPHNMSMLYPPVSYLSQTGFMQPNISSMSLLSGGLKRQETHGYE
SDHHNLVHMNHETGTAPDHEDTTADMKVEP
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaaagacgagtttgccgcaaagaagaaggatttggtcaatacgccagtggat
ttgtatcctccggagaatccaatgttgggtccttctccgatgatggattcattcagagaa
actctttggcatgatggtggtttcaatgtccacacagatgcagacacttcctttagaggt
aataataatattgatatacctcttgaaatgggttggaatatggctcagttccctgcagat
tcaggattcattgagcgtgctgcaaagttttctttttttggatgtggtgaaatgatgatg
aaccaacaacaatcatctcttggagttccagattcaactggcttgtttcttcaagataca
cagattcctagtggatccaaactagataatggtcctcttactgatgcatctaagttagtg
aaagagagatcgattaataatgtatcagaggattctcaatctagtggaggtaatggtcat
gatgatgctaagtgtgggcaaacatcttccaaggggtttagtagtaagaagaggaaaaga
attgggaaggattgtgaagaagaagaagataaaaagcaaaaggatgagcaaagtccaact
tcaaatgcgaacaagacaaacagtgagaagcaaccttctgattctttaaaggatgggtat
attcacatgagggcacgaagaggccaggctactaatagtcacagtcttgctgaaagagta
agaagagaaaaaatcagtgaaaggatgaagttcttgcaagatcttgtgccaggttgcgac
aaggtgactggtaaggcagttatgctcgatgaaatcattaactatgtgcaatcacttcaa
tgccaaatcgagtttttatcgatgaaactttcggctgtgaatcctgtgctcgattttaac
ctcgaaagcctccttgcaaaagatgctcttcaatcatctgcaccgacatttccccacaac
atgtcgatgctttatcctcctgtatcgtatctctctcaaacaggattcatgcaaccgaac
atttcctcaatgtcgctattgagtggaggattaaaacggcaggaaacacatggatatgaa
agtgatcaccacaatcttgtccacatgaaccatgaaaccggcactgcacctgatcatgaa
gatacaacagctgacatgaaggtggagccgtag

DBGET integrated database retrieval system