KEGG   Arabidopsis thaliana (thale cress): AT1G26310Help
Entry
AT1G26310         CDS       T00041                                 

Gene name
CAL
Definition
(RefSeq) K-box region and MADS-box transcription factor family protein
  KO
K09264  MADS-box transcription factor, plant
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Transcription factors [BR:ath03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, Homeotic genes
    AT1G26310 (CAL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: K-box SRF-TF ATP-synt_G Prominin Laminin_I DUF2115 DUF1664 RP-C_C FapA Bcr-Abl_Oligo Sec2p
Motif
Other DBs
NCBI-GeneID: 839172
NCBI-ProteinID: NP_564243
MIPS: AT1G26310.1
TAIR: AT1G26310
Araport: AT1G26310
UniProt: Q39081
Position
1
AA seq 255 aa AA seqDB search
MGRGRVELKRIENKINRQVTFSKRRTGLLKKAQEISVLCDAEVSLIVFSHKGKLFEYSSE
SCMEKVLERYERYSYAERQLIAPDSHVNAQTNWSMEYSRLKAKIELLERNQRHYLGEELE
PMSLKDLQNLEQQLETALKHIRSRKNQLMNESLNHLQRKEKEIQEENSMLTKQIKERENI
LRTKQTQCEQLNRSVDDVPQPQPFQHPHLYMIAHQTSPFLNMGGLYQEEDQTAMRRNNLD
LTLEPIYNYLGCYAA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggaaggggtagggttgaattgaagaggatagagaacaagatcaatagacaagtgaca
ttctcgaaaagaagaactggtcttttgaagaaagctcaggagatctctgttctttgtgat
gccgaggtttcccttattgtcttctcccataagggcaaattgttcgagtactcctctgaa
tcttgcatggagaaggtactagaacgctacgagaggtattcttacgccgagagacagctg
attgcacctgactctcacgttaatgcacagacgaactggtcaatggagtatagcaggctt
aaggccaagattgagcttttggagagaaaccaaaggcattatctgggagaagagttggaa
ccaatgagcctcaaggatctccaaaatctggagcagcagcttgagactgctcttaagcac
attcgctccagaaaaaatcaactcatgaatgagtccctcaaccacctccaaagaaaggag
aaggagatacaggaggaaaacagcatgcttaccaaacagataaaggagagggaaaacatc
ctaaggacaaaacaaacccaatgtgagcagctgaaccgcagcgtcgacgatgtaccacag
ccacaaccatttcaacacccccatctttacatgatcgctcatcagacttctcctttccta
aatatgggtggtttgtaccaagaagaagaccaaacggcgatgaggaggaacaatctggat
ctgactcttgaacccatttacaattaccttggctgttacgccgcttga

DBGET integrated database retrieval system