KEGG   Arabidopsis thaliana (thale cress): AT1G26310Help
Entry
AT1G26310         CDS       T00041                                 

Gene name
CAL
Definition
(RefSeq) transcription factor CAULIFLOWER
  KO
K09264  
MADS-box transcription factor, plant
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Transcription factors [BR:ath03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, Homeotic genes
    AT1G26310 (CAL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 255 aa AA seqDB search
MGRGRVELKRIENKINRQVTFSKRRTGLLKKAQEISVLCDAEVSLIVFSHKGKLFEYSSE
SCMEKVLERYERYSYAERQLIAPDSHVNAQTNWSMEYSRLKAKIELLERNQRHYLGEELE
PMSLKDLQNLEQQLETALKHIRSRKNQLMNESLNHLQRKEKEIQEENSMLTKQIKERENI
LRTKQTQCEQLNRSVDDVPQPQPFQHPHLYMIAHQTSPFLNMGGLYQEEDQTAMRRNNLD
LTLEPIYNYLGCYAA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggaaggggtagggttgaattgaagaggatagagaacaagatcaatagacaagtgaca
ttctcgaaaagaagaactggtcttttgaagaaagctcaggagatctctgttctttgtgat
gccgaggtttcccttattgtcttctcccataagggcaaattgttcgagtactcctctgaa
tcttgcatggagaaggtactagaacgctacgagaggtattcttacgccgagagacagctg
attgcacctgactctcacgttaatgcacagacgaactggtcaatggagtatagcaggctt
aaggccaagattgagcttttggagagaaaccaaaggcattatctgggagaagagttggaa
ccaatgagcctcaaggatctccaaaatctggagcagcagcttgagactgctcttaagcac
attcgctccagaaaaaatcaactcatgaatgagtccctcaaccacctccaaagaaaggag
aaggagatacaggaggaaaacagcatgcttaccaaacagataaaggagagggaaaacatc
ctaaggacaaaacaaacccaatgtgagcagctgaaccgcagcgtcgacgatgtaccacag
ccacaaccatttcaacacccccatctttacatgatcgctcatcagacttctcctttccta
aatatgggtggtttgtaccaagaagaagaccaaacggcgatgaggaggaacaatctggat
ctgactcttgaacccatttacaattaccttggctgttacgccgcttga

DBGET integrated database retrieval system