KEGG   Arabidopsis thaliana (thale cress): AT1G27890Help
Entry
AT1G27890         CDS       T00041                                 

Definition
(RefSeq) putative CCR4-associated factor 1-4
  KO
K12581  
CCR4-NOT transcription complex subunit 7/8
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AT1G27890
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     AT1G27890
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     AT1G27890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 302 aa AA seqDB search
MGEVWRWNKEVEMDSIRDCLKHFSSIAIDTEFPGCLKETPMDASEEIRYRDMKFNVDNTH
LIQLGFTLFDRRGITKTWEINLSDFNEHKCFKNDKSIAFLKSNGLNLDKIGEEGIGIEEF
FRDFSQILKEKDGKITWVNFQGSYDNAYLVKGLTGGKPLPETKEEFHETVEQLLGKFVFD
VKKIAESCSGLSSRFGLQRIADVLQMKRVGKAHHAGSDSELTARVFTKLTFDLLNSRKQC
VRRVDHQQYQLEQQQLMMTRCYIPIPIPIPRPRSVMFAAHHPNPYFGGGYFGMPVQGRNY
VL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagtttggagatggaacaaggaagtagagatggattcgataagagattgtttg
aaacattttagttccatcgctatcgacacagagtttcccggatgcttaaaggagactccg
atggacgcgagtgaggaaattcgttacagagacatgaagttcaatgtggacaacacccat
ctcatccagttaggtttcacgctattcgacagaagaggaatcactaaaacctgggaaata
aacttgtcagatttcaacgaacataagtgcttcaaaaacgataagtccatagcttttctc
aaaagcaatggtctcaatctggacaagatcggagaggaaggtattggaatcgaagaattc
tttagagacttttctcagattctcaaggagaaggacggaaagataacttgggtgaatttt
caaggctcttacgacaatgcttatctcgttaaaggcttaacgggagggaaaccgttaccg
gagactaaggaagagtttcacgagaccgtcgagcagcttttgggaaagtttgtttttgac
gtaaagaaaatcgctgaatcatgcagcggactaagtagccgattcggactacagagaata
gctgatgtgttgcagatgaaacgtgttggaaaagctcatcacgctggctcagacagtgaa
ttgacggctcgtgtcttcactaagttgactttcgatttgctcaatagtagaaagcagtgt
gtaagacgagttgatcatcagcaatatcaactagagcagcagcagcttatgatgactaga
tgttacatcccaataccgatacctataccgagaccgagatcggtgatgtttgctgctcat
cacccgaacccgtattttggtggtggttactttgggatgccggtccaaggaaggaactac
gttttgtga

DBGET integrated database retrieval system