KEGG   Arabidopsis thaliana (thale cress): AT1G29550Help
Entry
AT1G29550         CDS       T00041                                 

Definition
(RefSeq) Eukaryotic initiation factor 4E protein
  KO
K03259  
translation initiation factor 4E
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AT1G29550
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     AT1G29550
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     AT1G29550
Translation factors [BR:ath03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    AT1G29550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
1
AA seq 240 aa AA seqDB search
MVVTDSPVSGIMADQNIDPNTTTSPSPKEKHVSAIKAISGDEKAPSKEKKNYASKKSTTV
IQKSHCFQNSWTFWFDNPSSKSNQVIWGSSLRSLYTFGTIEEFWSLYNNIHPPTKWVSGA
DLYCFKDKIEPKWEDPICANGGKWSMMFPKATLECNWLNTLLALVGEQFDQGDEICGAVL
NFRARGDRISLWTKNAANEEAQLSIGKQWKELLGYNETIGFIVHEDAKTLDRDAKRRYTV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggtggttacggattctccagtttcggggataatggctgatcagaacatcgatcctaac
accacgacgagccctagtcctaaagagaagcatgtttctgcgattaaggctatctccggc
gacgagaaagctccgtcgaaggagaaaaagaactacgcgtcgaagaaatcaactaccgta
atccagaaatcgcactgtttccagaattcttggacattttggttcgataatccttcctcc
aaatcgaatcaagtcatatggggaagctctttgagatccttgtatacattcggtactatc
gaagagttctggagtctctacaataacattcatcctccaaccaagtgggtttcgggggcg
gatctttactgcttcaaagataagattgaaccaaaatgggaagatcctatctgtgctaat
ggaggaaaatggagtatgatgttccctaaagctacactagaatgcaattggcttaacacg
ttacttgcgttggttggtgagcaatttgaccaaggagatgagatctgtggagcagttttg
aacttcagagcgagaggggacaggatctctctatggacaaagaacgctgcaaatgaggag
gctcagctaagcattgggaagcagtggaaggaacttcttggctacaatgagacaatcgga
tttatagttcatgaggatgcaaagactcttgatcgtgatgctaaacgtcgatatactgta
tga

DBGET integrated database retrieval system