KEGG   Arabidopsis thaliana (thale cress): AT1G29590Help
Entry
AT1G29590         CDS       T00041                                 

Gene name
eIF4E3
Definition
translation initiation factor eIF-4E
Orthology
K03259  
translation initiation factor 4E
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AT1G29590 (eIF4E3)
Translation factors [BR:ath03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    AT1G29590 (eIF4E3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 300 aa AA seqDB search
MVVMDSPVSGRMADQNIDPNTTTSPSPIEKHVSAIKAISGDEKAPSKEKKNYASKKSTTV
IQKSHCFQNSWTFWFDNPSSKSNQVIWGSSLRSLYTFATIEEFWSLYNNIHPPTKWVSGS
DLYCFKDKIEPKWEDPICANGGKWTMFFPRATLESNWLNTLLALVGEQFDQGDEICGAVL
NFRTRGDRISLWTKKAANEEAQLSIGKQWKELLGYNDTIGFIVHEDAKTLDRDAKRRYTI
YMNKVNCGEDFINTGRRRTIVDPHLSHGDEKDPSKQRKSDECVSKKSTTVIQKPHCFKNS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggtggttatggattctccagtttcggggagaatggctgatcagaacatcgatcctaac
accacgacgagccctagtcctatagagaagcatgtttcggcgattaaggctatctccggc
gacgagaaagctccgtcgaaggagaaaaagaactacgcgtcgaagaaatcaactaccgta
atccagaaatcgcactgtttccagaattcttggacattttggttcgataatccttcctcc
aaatcgaatcaagtcatatggggaagctctttgagatctttgtatacattcgctaccatc
gaagagttctggagtctttacaataacattcatcctccaaccaagtgggtgtcagggtcg
gatctctactgcttcaaagataagattgaaccaaaatgggaagatcctatctgtgccaat
ggaggaaaatggactatgtttttccctagagctacactagaatctaattggcttaacacg
ttacttgcgttggttggtgagcaatttgaccaaggagatgagatctgtggagcagttttg
aacttcagaacgagaggggacaggatctctctatggacaaagaaagctgcaaatgaggag
gctcagctaagcattgggaagcagtggaaggaacttcttggctacaatgacacaatcgga
tttatagttcatgaggatgcaaagactcttgatcgtgatgctaaacgtcgatatactata
tatatgaacaaagtgaattgtggagaagacttcattaacactggtcgaagacggactatt
gtcgatccgcatctatctcacggtgacgagaaagatccgtcgaagcagagaaagagcgat
gaatgtgtgtcgaagaaatcaacaaccgtaatccagaaaccacattgcttcaagaattct
tga

DBGET integrated database retrieval system