KEGG   Arabidopsis thaliana (thale cress): AT1G29590Help
Entry
AT1G29590         CDS       T00041                                 

Gene name
eIF4E3
Definition
translation initiation factor eIF-4E
Orthology
K03259  
translation initiation factor 4E
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AT1G29590 (eIF4E3)
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     AT1G29590 (eIF4E3)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     AT1G29590 (eIF4E3)
Translation factors [BR:ath03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    AT1G29590 (eIF4E3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 300 aa AA seqDB search
MVVMDSPVSGRMADQNIDPNTTTSPSPIEKHVSAIKAISGDEKAPSKEKKNYASKKSTTV
IQKSHCFQNSWTFWFDNPSSKSNQVIWGSSLRSLYTFATIEEFWSLYNNIHPPTKWVSGS
DLYCFKDKIEPKWEDPICANGGKWTMFFPRATLESNWLNTLLALVGEQFDQGDEICGAVL
NFRTRGDRISLWTKKAANEEAQLSIGKQWKELLGYNDTIGFIVHEDAKTLDRDAKRRYTI
YMNKVNCGEDFINTGRRRTIVDPHLSHGDEKDPSKQRKSDECVSKKSTTVIQKPHCFKNS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggtggttatggattctccagtttcggggagaatggctgatcagaacatcgatcctaac
accacgacgagccctagtcctatagagaagcatgtttcggcgattaaggctatctccggc
gacgagaaagctccgtcgaaggagaaaaagaactacgcgtcgaagaaatcaactaccgta
atccagaaatcgcactgtttccagaattcttggacattttggttcgataatccttcctcc
aaatcgaatcaagtcatatggggaagctctttgagatctttgtatacattcgctaccatc
gaagagttctggagtctttacaataacattcatcctccaaccaagtgggtgtcagggtcg
gatctctactgcttcaaagataagattgaaccaaaatgggaagatcctatctgtgccaat
ggaggaaaatggactatgtttttccctagagctacactagaatctaattggcttaacacg
ttacttgcgttggttggtgagcaatttgaccaaggagatgagatctgtggagcagttttg
aacttcagaacgagaggggacaggatctctctatggacaaagaaagctgcaaatgaggag
gctcagctaagcattgggaagcagtggaaggaacttcttggctacaatgacacaatcgga
tttatagttcatgaggatgcaaagactcttgatcgtgatgctaaacgtcgatatactata
tatatgaacaaagtgaattgtggagaagacttcattaacactggtcgaagacggactatt
gtcgatccgcatctatctcacggtgacgagaaagatccgtcgaagcagagaaagagcgat
gaatgtgtgtcgaagaaatcaacaaccgtaatccagaaaccacattgcttcaagaattct
tga

DBGET integrated database retrieval system