KEGG   Arabidopsis thaliana (thale cress): AT1G29920Help
Entry
AT1G29920         CDS       T00041                                 

Gene name
CAB2
Definition
(RefSeq) chlorophyll A/B-binding protein 2
  KO
K08912  
light-harvesting complex II chlorophyll a/b binding protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Photosynthesis - antenna proteins
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Energy metabolism
   00196 Photosynthesis - antenna proteins
    AT1G29920 (CAB2)
Photosynthesis proteins [BR:ath00194]
 Antenna proteins
  Light-harvesting chlorophyll-protein complex (LHC) - Plant, Green alga [OT]
   LHCII
    AT1G29920 (CAB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 267 aa AA seqDB search
MAASTMALSSPAFAGKAVNLSPAASEVLGSGRVTMRKTVAKPKGPSGSPWYGSDRVKYLG
PFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLA
RNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGN
GPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP
IENLADHLADPVNNNAWAFATNFVPGK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctcaacaatggctctctcctcccctgctttcgccggaaaggctgtgaacctt
tcccctgcggcatcagaagtccttggaagcggccgtgtgacaatgaggaagactgttgcc
aagccaaagggtccatcaggcagcccatggtacggatccgaccgagtcaagtacttgggt
ccattctctggcgagtcacccagctaccttaccggagagttccctggagactacggatgg
gacacagctggtctatccgctgaccccgagacattcgcaaggaaccgtgagctagaagtt
atccacagcaggtgggccatgctcggagccctaggctgcgtcttccctgagcttttggcc
aggaacggagtcaagtttggagaggcagtttggttcaaggctggttcacagatcttcagc
gatggagggctcgattacttgggaaaccctagcttggttcacgctcagagcattttggcc
atttgggccacacaagttattttgatgggagccgttgaaggttacagagtcgcaggaaat
gggccattgggagaggccgaggacttgctttaccccggtggcagtttcgacccattgggt
ttggctaccgacccagaggccttcgctgagttgaaggtaaaggagctcaagaacggaaga
ttggctatgttctctatgtttggattcttcgttcaagccatcgtcactggtaagggaccg
atagagaaccttgctgaccatttggccgatccagtcaacaacaacgcttgggcctttgcc
accaactttgttcccggaaagtga

DBGET integrated database retrieval system