KEGG   Arabidopsis thaliana (thale cress): AT1G31920Help
Entry
AT1G31920         CDS       T00041                                 

Definition
(RefSeq) Tetratricopeptide repeat (TPR)-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR DYW_deaminase PPR_2 PPR_1 PPR_3 PPR_long Peripla_BP_4 RecR
Motif
Other DBs
NCBI-GeneID: 840082
NCBI-ProteinID: NP_174474
MIPS: AT1G31920.1
TAIR: AT1G31920
Araport: AT1G31920
UniProt: Q9C6T2
Position
1
AA seq 606 aa AA seqDB search
MIKAPILQSLLASRDDLTHNPEVNNFGGKEQECLYLLKRCHNIDEFKQVHARFIKLSLFY
SSSFSASSVLAKCAHSGWENSMNYAASIFRGIDDPCTFDFNTMIRGYVNVMSFEEALCFY
NEMMQRGNEPDNFTYPCLLKACTRLKSIREGKQIHGQVFKLGLEADVFVQNSLINMYGRC
GEMELSSAVFEKLESKTAASWSSMVSARAGMGMWSECLLLFRGMCSETNLKAEESGMVSA
LLACANTGALNLGMSIHGFLLRNISELNIIVQTSLVDMYVKCGCLDKALHIFQKMEKRNN
LTYSAMISGLALHGEGESALRMFSKMIKEGLEPDHVVYVSVLNACSHSGLVKEGRRVFAE
MLKEGKVEPTAEHYGCLVDLLGRAGLLEEALETIQSIPIEKNDVIWRTFLSQCRVRQNIE
LGQIAAQELLKLSSHNPGDYLLISNLYSQGQMWDDVARTRTEIAIKGLKQTPGFSIVELK
GKTHRFVSQDRSHPKCKEIYKMLHQMEWQLKFEGYSPDLTQILLNVDEEEKKERLKGHSQ
KVAIAFGLLYTPPGSIIKIARNLRMCSDCHTYTKKISMIYEREIVVRDRNRFHLFKGGTC
SCKDYW
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggcaccaattctacagtctctattggcttctagagacgatttaactcataac
ccagaagtcaacaactttggagggaaagagcaagaatgtttatacctcttgaagagatgc
cacaacatagacgagttcaagcaagttcacgccagattcatcaagctaagtttgttctat
tcttcttcattctcagccagcagcgttctcgcaaaatgcgctcactcgggatgggagaac
agtatgaattacgcagcttccatattcagaggcatagatgatccttgtacctttgatttc
aatacaatgattagagggtatgttaacgtaatgagtttcgaggaagcattgtgtttttac
aatgagatgatgcagagagggaatgagccagataatttcacgtacccgtgtcttctcaag
gcttgcactcgtttgaagtcaattcgagaagggaagcagattcatgggcaagtgtttaag
ctcggtcttgaagctgacgtgtttgttcagaatagtttgatcaatatgtatggaagatgt
ggagagatggaactttcttctgcggtttttgagaaactggaatctaaaacagctgcgtcg
tggagctcgatggtctctgctcgtgcaggcatgggaatgtggagcgaatgcttgttacta
ttccgtggaatgtgtagcgaaacgaatttgaaggcggaagaaagtggaatggttagtgct
ctcttagcttgtgccaacaccggtgcactcaatctaggaatgagcatccatggcttcctg
ttgagaaacataagcgaactcaacataatagtccaaacttcactagtagatatgtacgtt
aaatgcgggtgcttagacaaagcgttgcatatatttcagaagatggaaaagaggaataat
ttgacttacagtgcaatgatctcaggacttgcgttgcacggagaaggagaatcagcttta
agaatgttctctaagatgatcaaagaaggtttagaaccagatcatgttgtgtatgtcagt
gttctcaatgcatgtagtcactctggtcttgttaaagaaggtcgtcgagtcttcgcagaa
atgttaaaggaaggtaaggtggagccaacggctgagcattacggctgtcttgtagatctt
ctgggaagagccggattgctcgaggaagcattggagactatccaaagcataccaattgag
aaaaatgatgttatctggagaaccttcttaagtcaatgcagagttcgtcagaacattgag
ctaggccaaatagcagctcaagaactgcttaagctaagctcacacaacccaggtgactat
ttgctgatctctaacttgtattcacaaggtcaaatgtgggatgatgtagccagaactcga
acagaaatcgctatcaagggtttgaaacaaaccccgggttttagcatcgtcgagctaaaa
ggtaaaacccacaggttcgtttcacaagatcgatcgcacccaaaatgcaaagaaatctac
aagatgctacaccagatggaatggcaactaaaattcgaaggatattcaccagacttgaca
cagatattgctaaacgtagatgaagaagaaaagaaagagagattaaaaggacacagccaa
aaggtggctattgcctttggactattgtatacacctccagggtctatcattaaaatagct
agaaacctgaggatgtgtagtgactgtcacacatatacaaagaaaatctccatgatctac
gaaagagagattgttgtaagagacagaaacaggtttcacctgtttaaaggtggaacttgt
tcttgtaaagattattggtag

DBGET integrated database retrieval system