KEGG   Arabidopsis thaliana (thale cress): AT1G32230Help
Entry
AT1G32230         CDS       T00041                                 

Gene name
RCD1
Definition
(RefSeq) inactive poly [ADP-ribose] polymerase RCD1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 589 aa AA seqDB search
MEAKIVKVLDSSRCEDGFGKKRKRAASYAAYVTGVSCAKLQNVPPPNGQCQIPDKRRRLE
GENKLSAYENRSGKALVRYYTYFKKTGIAKRVMMYENGEWNDLPEHVICAIQNELEEKSA
AIEFKLCGHSFILDFLHMQRLDMETGAKTPLAWIDNAGKCFFPEIYESDERTNYCHHKCV
EDPKQNAPHDIKLRLEIDVNGGETPRLNLEECSDESGDNMMDDVPLAQRSSNEHYDEATE
DSCSRKLEAAVSKWDETDAIVVSGAKLTGSEVLDKDAVKKMFAVGTASLGHVPVLDVGRF
SSEIAEARLALFQKQVEITKKHRGDANVRYAWLPAKREVLSAVMMQGLGVGGAFIRKSIY
GVGIHLTAADCPYFSARYCDVDENGVRYMVLCRVIMGNMELLRGDKAQFFSGGEEYDNGV
DDIESPKNYIVWNINMNTHIFPEFVVRFKLSNLPNAEGNLIAKRDNSGVTLEGPKDLPPQ
LESNQGARGSGSANSVGSSTTRPKSPWMPFPTLFAAISHKVAENDMLLINADYQQLRDKK
MTRAEFVRKLRVIVGDDLLRSTITTLQNQPKSKEIPGSIRDHEEGAGGL
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggaagccaagatcgtcaaggtgttggatagtagtaggtgtgaagatggattcggaaaa
aagaggaagcgcgcagcaagctatgctgcatatgttactggagtttcgtgtgcaaagctg
caaaatgtgcccccaccgaacgggcagtgccaaattcctgacaaaagaagaaggctggaa
ggtgaaaacaagcttagcgcttacgagaatcgctctgggaaggcgctggtcagatattac
acttattttaagaagactggaatcgctaaacgtgttatgatgtatgagaatggcgaatgg
aatgatttgcctgagcacgttatatgcgccatccagaatgaattagaagaaaagagcgcc
gcaattgagttcaagttatgcggtcacagttttattttggacttcttgcacatgcaaaga
ctagacatggaaacaggagcaaaaacccctcttgcatggattgacaatgcaggaaagtgc
tttttccctgaaatttatgagagtgatgaaaggaccaattactgccatcataaatgtgtg
gaagacccaaaacagaatgctcctcatgatatcaaacttcgcctagagattgatgttaat
ggtggcgagacaccgaggttaaatttggaggagtgcagtgatgagtctggtgataatatg
atggacgatgttccccttgctcaacgatcttcaaatgagcactatgacgaggctacggag
gatagctgcagccgcaagctcgaagctgctgtttcgaaatgggatgagactgatgctata
gtcgtctctggtgccaagcttacgggaagcgaagtacttgataaagatgcagtaaaaaaa
atgtttgctgtaggcacagcttctctaggacatgtaccagtgctggatgtgggccgtttt
tccagtgagattgctgaagctcgtctagcacttttccagaagcaggttgagatcactaag
aaacatcgaggggatgcaaacgttaggtatgcctggcttcctgcaaagagggaagtttta
tcagcagtgatgatgcaaggacttggagttggtggagcatttatcagaaagtccatctat
ggtgttgggatccatttaaccgctgcagactgcccttatttcagtgctagatactgtgat
gttgacgaaaacggagtacgttacatggttttatgccgtgtgattatggggaatatggag
cttcttcgtggtgataaagctcagttcttttctggtggagaagaatatgacaatggagtc
gatgacattgagagtccaaagaattacattgtctggaacatcaatatgaacacacatata
ttcccggaatttgttgttaggttcaagctgtctaatctccccaatgctgaaggtaatttg
attgctaagcgtgataactcaggggtcactttggaaggacctaaggatcttcctcctcaa
ttggagtcaaaccagggagcaagaggttcaggaagtgcaaacagtgttggttcaagcact
acaagacccaaatctccatggatgccatttcctactctgtttgcagcaatctcacataag
gttgcagagaacgacatgttgttgatcaatgctgactaccaacaactgagggataagaag
atgacgagagcggagtttgtcaggaaactgcgggtgattgtaggagatgatctgctaagg
tccaccataacaacccttcaaaaccagccaaagtcgaaggagattccaggaagcatcaga
gaccatgaagaaggtgcaggtggattgtaa

DBGET integrated database retrieval system