KEGG   Arabidopsis thaliana (thale cress): AT1G32850Help
Entry
AT1G32850         CDS       T00041                                 

Gene name
UBP11
Definition
putative ubiquitin carboxyl-terminal hydrolase 11
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AT1G32850 (UBP11)
Peptidases [BR:ath01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AT1G32850 (UBP11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 892 aa AA seqDB search
MTLITDSESIGVCESSYTPEEERRIVTELNNEAEADLKEGNLYFVISNRWYTRWQRFVGL
LTEEFRSGEPSEVTRPGPIDNHDIIDSESDASDPQLRMMLEEGVDYTLVQQEVWRKLVKW
YKGGPPVPRKLISQGFYTKSFSVEVYLLCLTLTDSRDESTTIIRLSKQASIGQLYEMVCA
GKGVAKEKARIWDYFEKKKSVLLDPSSEQSVEEAGLQFNQDILLEVDGSASSQFVMSLAE
NELAMVPLEPMRSDAMDIVRGGGTLSNGHSNGFKFSFFGRNTFKDDVSSRTFGKGEKRGL
GGLQNLGNTCFMNSTLQCLAHTPPIVEYFLQDYRSDINAKNPLGMRGELAIAFGELLRKL
WSSGQNTVAPRAFKTKLARFAPQFSGYNQHDSQEMLAFLLDGLHEDLNKVKRKPYIEAKD
SDGRPDDEVAEEKWKYHKARNDSVIVDVFQGQYKSTLVCPDCGKISITFDPFMYLSLPLP
SSRTRSMTVTVFYGDGSHLPMPYTVTVPKDGSCRDLSNALGTACCLDNDESLLLAEVYDH
KVFKYYENPRELLNGIKDNEHIVAYRFKQMHKGPGKVKLEILHGEQEKSSDRGPKCFGTP
LVTYINKEPLSGTDIATSISGLLSPLRRVHMSCVVNSGNENGHVPDESSRSILSRDTETE
DNDRELSLSLLRDYYSFNLQPLESDSVVNPGSVTKVLVKWNEKEHEKYDSSYLNDLPKVH
KNVLAKKTMQEGISLFSCLEAFLAEEPLGPDDMWYCPGCKEHRQANKKLDLWKLPDILVF
HLKRFTYSRYFKNKIDTLVNFHIHDLDLSKYVKNEDGQSYLYELYAISNHYGGLGGGHYT
AYAKLMDETKWYNFDDSRVSAVNESEIKTSAAYVLFYQRVKSDSETSDMKMD
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atgacattaatcactgattctgaatccatcggagtttgtgaatcctcctatactcctgag
gaagagagacgtattgtcaccgagcttaataacgaagccgaggctgatttgaaagaggga
aacttgtatttcgttatctcaaacaggtggtatacaagatggcagaggtttgttgggcta
ctaacagaagaatttcgtagtggagagccttcagaagttacccgacctggtccaattgat
aatcatgatataattgatagtgaaagtgatgctagtgatccgcaacttcgtatgatgctg
gaggaaggtgtcgactatactctagttcaacaagaagtttggagaaaactcgttaaatgg
tataaaggaggtcctccagtaccgagaaagttgatatctcaagggttttacactaagagc
tttagtgtggaggtttacctactgtgtcttaccttgacagacagtagagacgaaagcact
accatcataaggttgagcaaacaggcttctataggtcaactttatgagatggtttgtgct
ggaaaaggggtagcaaaagaaaaggctcgcatatgggattactttgagaaaaagaaaagc
gtactcttggatccttcatctgaacaaagtgtggaggaagcgggccttcaattcaaccaa
gatattcttcttgaggttgatggatctgcatcttctcaatttgtcatgagcttggctgaa
aatgaattagctatggtacctctagagcctatgaggtcagatgctatggatattgtgcgt
ggtggagggaccttatctaatggtcactccaacggttttaagtttagcttctttgggaga
aacactttcaaagatgatgtttcttcaaggacttttgggaaaggagagaagagaggttta
ggaggattgcaaaatttgggaaatacatgcttcatgaatagtactcttcagtgtttggct
catacaccccctattgttgaatattttctacaagattaccgctccgacataaatgcaaag
aatcctttgggaatgcgtggtgagcttgcaattgcatttggtgaacttttgaggaaattg
tggtcatctggacaaaatacagttgcgccgcgcgcttttaagacaaaattggctcgattt
gctccacaatttagtggttataatcagcatgattctcaagaaatgcttgctttcttattg
gatgggcttcatgaagacttgaacaaggtaaaacgaaaaccttatattgaagctaaagat
tcagatggtcgtccagatgatgaagtagccgaagaaaagtggaaataccataaggcccga
aatgactctgtgatagttgacgtcttccaaggacaatacaagtcaacattggtgtgtcca
gattgtggaaaaatctcaatcacatttgaccccttcatgtacttatctttgccgttgcca
tcaagtcgcactcgatcaatgactgttacagtgttttatggcgatggaagtcaccttccg
atgccatacactgtaacagttcctaaagacggttcttgtagagatctcagtaatgcatta
ggcactgcttgctgcttggacaatgacgaaagccttttacttgcagaggtgtatgaccac
aaggtctttaagtattatgaaaatccccgggagttgctgaatgggataaaagacaatgaa
catattgtggcatatcggttcaagcagatgcacaaaggaccaggaaaagtcaaactagaa
attcttcatggggagcaggaaaagtctagtgacaggggcccaaagtgttttggaactccc
ctagtcacttatatcaacaaagaaccacttagtggaacagacattgctactagcatctct
ggattgttgtcacctctacgccgggttcatatgtcatgtgtagttaatagtggaaacgag
aatggccacgttccagatgaatcatccagaagtatattatctagagacacggaaacagag
gataatgatagagaattatccttgagcctcttacgagattactattctttcaatctccag
ccacttgagtccgattccgttgtgaatcctggtagtgttacaaaggttttagtcaagtgg
aacgagaaagagcatgagaaatatgactcaagctacttgaatgatctacctaaggttcat
aaaaatgtcttggcaaagaagacaatgcaagagggaatatctttgttttcatgcttggaa
gcctttctagcagaagagcctctaggaccagatgacatgtggtattgtcctggttgcaaa
gaacatagacaagcgaacaagaagctagacttgtggaagttgccagatattcttgtgttc
cacctgaaacggttcacgtatagcagatatttcaagaataagattgatacgttagtgaac
ttccatattcacgatctagatcttagcaagtacgtaaagaacgaagacggtcagtcatat
ctttacgagctgtatgcgattagcaatcattatggtggccttggaggtggtcactacact
gcttacgctaagttgatggatgagaccaaatggtataattttgatgacagccgtgtttca
gctgtaaatgaatccgagatcaagacttcggctgcttacgttttgttctatcaaagagtg
aaaagtgattcagagacatcggatatgaaaatggattag

DBGET integrated database retrieval system