KEGG   Arabidopsis thaliana (thale cress): AT1G32850Help
Entry
AT1G32850         CDS       T00041                                 

Gene name
UBP11
Definition
(RefSeq) putative ubiquitin carboxyl-terminal hydrolase 11
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AT1G32850 (UBP11)
Peptidases [BR:ath01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AT1G32850 (UBP11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 892 aa AA seqDB search
MTLITDSESIGVCESSYTPEEERRIVTELNNEAEADLKEGNLYFVISNRWYTRWQRFVGL
LTEEFRSGEPSEVTRPGPIDNHDIIDSESDASDPQLRMMLEEGVDYTLVQQEVWRKLVKW
YKGGPPVPRKLISQGFYTKSFSVEVYLLCLTLTDSRDESTTIIRLSKQASIGQLYEMVCA
GKGVAKEKARIWDYFEKKKSVLLDPSSEQSVEEAGLQFNQDILLEVDGSASSQFVMSLAE
NELAMVPLEPMRSDAMDIVRGGGTLSNGHSNGFKFSFFGRNTFKDDVSSRTFGKGEKRGL
GGLQNLGNTCFMNSTLQCLAHTPPIVEYFLQDYRSDINAKNPLGMRGELAIAFGELLRKL
WSSGQNTVAPRAFKTKLARFAPQFSGYNQHDSQEMLAFLLDGLHEDLNKVKRKPYIEAKD
SDGRPDDEVAEEKWKYHKARNDSVIVDVFQGQYKSTLVCPDCGKISITFDPFMYLSLPLP
SSRTRSMTVTVFYGDGSHLPMPYTVTVPKDGSCRDLSNALGTACCLDNDESLLLAEVYDH
KVFKYYENPRELLNGIKDNEHIVAYRFKQMHKGPGKVKLEILHGEQEKSSDRGPKCFGTP
LVTYINKEPLSGTDIATSISGLLSPLRRVHMSCVVNSGNENGHVPDESSRSILSRDTETE
DNDRELSLSLLRDYYSFNLQPLESDSVVNPGSVTKVLVKWNEKEHEKYDSSYLNDLPKVH
KNVLAKKTMQEGISLFSCLEAFLAEEPLGPDDMWYCPGCKEHRQANKKLDLWKLPDILVF
HLKRFTYSRYFKNKIDTLVNFHIHDLDLSKYVKNEDGQSYLYELYAISNHYGGLGGGHYT
AYAKLMDETKWYNFDDSRVSAVNESEIKTSAAYVLFYQRVKSDSETSDMKMD
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atgacattaatcactgattctgaatccatcggagtttgtgaatcctcctatactcctgag
gaagagagacgtattgtcaccgagcttaataacgaagccgaggctgatttgaaagaggga
aacttgtatttcgttatctcaaacaggtggtatacaagatggcagaggtttgttgggcta
ctaacagaagaatttcgtagtggagagccttcagaagttacccgacctggtccaattgat
aatcatgatataattgatagtgaaagtgatgctagtgatccgcaacttcgtatgatgctg
gaggaaggtgtcgactatactctagttcaacaagaagtttggagaaaactcgttaaatgg
tataaaggaggtcctccagtaccgagaaagttgatatctcaagggttttacactaagagc
tttagtgtggaggtttacctactgtgtcttaccttgacagacagtagagacgaaagcact
accatcataaggttgagcaaacaggcttctataggtcaactttatgagatggtttgtgct
ggaaaaggggtagcaaaagaaaaggctcgcatatgggattactttgagaaaaagaaaagc
gtactcttggatccttcatctgaacaaagtgtggaggaagcgggccttcaattcaaccaa
gatattcttcttgaggttgatggatctgcatcttctcaatttgtcatgagcttggctgaa
aatgaattagctatggtacctctagagcctatgaggtcagatgctatggatattgtgcgt
ggtggagggaccttatctaatggtcactccaacggttttaagtttagcttctttgggaga
aacactttcaaagatgatgtttcttcaaggacttttgggaaaggagagaagagaggttta
ggaggattgcaaaatttgggaaatacatgcttcatgaatagtactcttcagtgtttggct
catacaccccctattgttgaatattttctacaagattaccgctccgacataaatgcaaag
aatcctttgggaatgcgtggtgagcttgcaattgcatttggtgaacttttgaggaaattg
tggtcatctggacaaaatacagttgcgccgcgcgcttttaagacaaaattggctcgattt
gctccacaatttagtggttataatcagcatgattctcaagaaatgcttgctttcttattg
gatgggcttcatgaagacttgaacaaggtaaaacgaaaaccttatattgaagctaaagat
tcagatggtcgtccagatgatgaagtagccgaagaaaagtggaaataccataaggcccga
aatgactctgtgatagttgacgtcttccaaggacaatacaagtcaacattggtgtgtcca
gattgtggaaaaatctcaatcacatttgaccccttcatgtacttatctttgccgttgcca
tcaagtcgcactcgatcaatgactgttacagtgttttatggcgatggaagtcaccttccg
atgccatacactgtaacagttcctaaagacggttcttgtagagatctcagtaatgcatta
ggcactgcttgctgcttggacaatgacgaaagccttttacttgcagaggtgtatgaccac
aaggtctttaagtattatgaaaatccccgggagttgctgaatgggataaaagacaatgaa
catattgtggcatatcggttcaagcagatgcacaaaggaccaggaaaagtcaaactagaa
attcttcatggggagcaggaaaagtctagtgacaggggcccaaagtgttttggaactccc
ctagtcacttatatcaacaaagaaccacttagtggaacagacattgctactagcatctct
ggattgttgtcacctctacgccgggttcatatgtcatgtgtagttaatagtggaaacgag
aatggccacgttccagatgaatcatccagaagtatattatctagagacacggaaacagag
gataatgatagagaattatccttgagcctcttacgagattactattctttcaatctccag
ccacttgagtccgattccgttgtgaatcctggtagtgttacaaaggttttagtcaagtgg
aacgagaaagagcatgagaaatatgactcaagctacttgaatgatctacctaaggttcat
aaaaatgtcttggcaaagaagacaatgcaagagggaatatctttgttttcatgcttggaa
gcctttctagcagaagagcctctaggaccagatgacatgtggtattgtcctggttgcaaa
gaacatagacaagcgaacaagaagctagacttgtggaagttgccagatattcttgtgttc
cacctgaaacggttcacgtatagcagatatttcaagaataagattgatacgttagtgaac
ttccatattcacgatctagatcttagcaagtacgtaaagaacgaagacggtcagtcatat
ctttacgagctgtatgcgattagcaatcattatggtggccttggaggtggtcactacact
gcttacgctaagttgatggatgagaccaaatggtataattttgatgacagccgtgtttca
gctgtaaatgaatccgagatcaagacttcggctgcttacgttttgttctatcaaagagtg
aaaagtgattcagagacatcggatatgaaaatggattag

DBGET integrated database retrieval system