KEGG   Arabidopsis thaliana (thale cress): AT1G36160Help
Entry
AT1G36160         CDS       T00041                                 

Gene name
ACC1
Definition
acetyl-CoA carboxylase 1
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AT1G36160 (ACC1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AT1G36160 (ACC1)
   00640 Propanoate metabolism
    AT1G36160 (ACC1)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    AT1G36160 (ACC1)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    AT1G36160 (ACC1)
Enzymes [BR:ath01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     AT1G36160 (ACC1)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     AT1G36160 (ACC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 2254 aa AA seqDB search
MAGSVNGNHSAVGPGINYETVSQVDEFCKALRGKRPIHSILIANNGMAAVKFIRSVRTWA
YETFGTEKAILLVGMATPEDMRINAEHIRIADQFVEVPGGTNNNNYANVQLIVEMAEVTR
VDAVWPGWGHASENPELPDALDAKGIIFLGPPASSMAALGDKIGSSLIAQAADVPTLPWS
GSHVKIPPNSNLVTIPEEIYRQACVYTTEEAIASCQVVGYPAMIKASWGGGGKGIRKVHN
DDEVRALFKQVQGEVPGSPIFIMKVASQSRHLEVQLLCDKHGNVSALHSRDCSVQRRHQK
IIEEGPITVAPPETVKKLEQAARRLAKSVNYVGAATVEYLYSMDTGEYYFLELNPRLQVE
HPVTEWIAEINLPAAQVAVGMGIPLWQIPEIRRFYGIEHGGGYDSWRKTSVVAFPFDFDK
AQSIRPKGHCVAVRVTSEDPDDGFKPTSGRVQELSFKSKPNVWAYFSVKSGGGIHEFSDS
QFGHVFAFGESRALAIANMVLGLKEIQIRGEIRTNVDYTIDLLHASDYRDNKIHTGWLDS
RIAMRVRAERPPWYLSVVGGALYKASATSAAVVSDYVGYLEKGQIPPKHISLVHSQVSLN
IEGSKYTIDVVRGGSGTYRLRMNKSEVVAEIHTLRDGGLLMQLDGKSHVIYAEEEAAGTR
LLIDGRTCLLQNDHDPSKLMAETPCKLMRYLISDNSNIDADTPYAEVEVMKMCMPLLSPA
SGVIHFKMSEGQAMQAGELIANLDLDDPSAVRKAEPFHGSFPRLGLPTAISGRVHQRCAA
TLNAARMILAGYEHKVDEVVQDLLNCLDSPELPFLQWQECFAVLATRLPKNLRNMLESKY
REFESISRNSLTTDFPAKLLKGILEAHLSSCDEKERGALERLIEPLMSLAKSYEGGRESH
ARVIVHSLFEEYLSVEELFNDNMLADVIERMRQLYKKDLLKIVDIVLSHQGIKNKNKLVL
RLMEQLVYPNPAAYRDKLIRFSTLNHTNYSELALKASQLLEQTKLSELRSNIARSLSELE
MFTEDGENMDTPKRKSAINERIEDLVSASLAVEDALVGLFDHSDHTLQRRVVETYIRRLY
QPYVVKDSVRMQWHRSGLLASWEFLEEHMERKNIGLDDPDTSEKGLVEKRSKRKWGAMVI
IKSLQFLPSIISAALRETKHNDYETAGAPLSGNMMHIAIVGINNQMSLLQDSGDEDQAQE
RVNKLAKILKEEEVSSSLCSAGVGVISCIIQRDEGRTPMRHSFHWSLEKQYYVEEPLLRH
LEPPLSIYLELDKLKGYSNIQYTPSRDRQWHLYTVTDKPVPIKRMFLRSLVRQATMNDGF
ILQQGQDKQLSQTLISMAFTSKCVLRSLMDAMEELELNAHNAAMKPDHAHMFLCILREQQ
IDDLVPFPRRVEVNAEDEETTVEMILEEAAREIHRSVGVRMHRLGVCEWEVRLWLVSSGL
ACGAWRVVVANVTGRTCTVHIYREVETPGRNSLIYHSITKKGPLHETPISDQYKPLGYLD
RQRLAARRSNTTYCYDFPLAFGTALELLWASQHPGVKKPYKDTLINVKELVFSKPEGSSG
TSLDLVERPPGLNDFGMVAWCLDMSTPEFPMGRKLLVIANDVTFKAGSFGPREDAFFLAV
TELACAKKLPLIYLAANSGARLGVAEEVKACFKVGWSDEISPENGFQYIYLSPEDHERIG
SSVIAHEVKLSSGETRWVIDTIVGKEDGIGVENLTGSGAIAGAYSKAYNETFTLTFVSGR
TVGIGAYLARLGMRCIQRLDQPIILTGFSTLNKLLGREVYSSHMQLGGPKIMGTNGVVHL
TVSDDLEGVSAILNWLSYIPAYVGGPLPVLAPLDPPERIVEYVPENSCDPRAAIAGVKDN
TGKWLGGIFDKNSFIETLEGWARTVVTGRAKLGGIPVGVVAVETQTVMQIIPADPGQLDS
HERVVPQAGQVWFPDSAAKTAQALMDFNREELPLFILANWRGFSGGQRDLFEGILQAGST
IVENLRTYRQPVFVYIPMMGELRGGAWVVVDSQINSDYVEMYADETARGNVLEPEGTIEI
KFRTKELLECMGRLDQKLISLKAKLQDAKQSEAYANIELLQQQIKAREKQLLPVYIQIAT
KFAELHDTSMRMAAKGVIKSVVEWSGSRSFFYKKLNRRIAESSLVKNVREASGDNLAYKS
SMRLIQDWFCNSDIAKGKEEAWTDDQVFFTWKDNVSNYELKLSELRAQKLLNQLAEIGNS
SDLQALPQGLANLLNKVEPSKREELVAAIRKVLG
NT seq 6765 nt NT seq  +upstreamnt  +downstreamnt
atggctggctcggttaacgggaatcatagtgctgtaggacctggtataaattatgagacg
gtgtctcaagtggatgagttctgtaaagcacttagagggaaaaggccgatccatagtatt
ttgatagctaacaatggaatggcggctgtgaagtttatacgtagtgtcagaacatgggct
tatgaaacatttggtacggaaaaagccatattgttggtggggatggcaacccctgaagac
atgcggatcaatgcggagcatatcagaatcgctgatcagtttgttgaggttcccggagga
accaacaataacaattatgctaacgttcagctgattgtggagatggctgaagtaacacgc
gtggatgcagtttggcctggttggggtcatgcatctgaaaaccccgaattacctgatgcc
ctagatgcaaaaggaatcatatttcttggtcctccagcatcttcaatggcagcactggga
gataagattggttcttcgttgattgcacaagctgctgatgtacccactctgccatggagt
ggttcccatgttaaaatacctcctaatagcaacttggtaaccatcccagaggagatctac
cggcaagcatgtgtctacacaactgaagaagcgattgctagctgtcaagttgtcggttac
ccagcaatgatcaaagcatcgtggggtggtggtggtaaaggaatcaggaaggttcataat
gatgatgaggttagggctctattcaagcaagttcagggtgaggtcccaggctcaccaata
ttcataatgaaggttgcgtcacagagtcggcatctagaggtccagctgctctgtgacaag
catggaaatgtttcagctctgcatagccgtgattgtagcgtccagagaagacatcaaaag
atcatagaggagggtccaattactgtggctccgccagaaactgtcaagaaacttgaacaa
gcagctagaaggttggctaagagtgttaactatgttggagctgctactgttgagtatctc
tacagtatggacactggggagtactacttcttagagcttaaccctcgcttacaggttgag
catcctgtcactgagtggattgccgagataaatcttcctgctgcccaagttgctgtgggg
atgggaattcctctctggcaaatccctgagataagacggttctatggaatagaacatggt
ggaggttatgattcttggcgaaaaacatctgttgtagccttcccttttgattttgataaa
gctcaatctataaggccaaaaggtcattgtgtggctgtacgtgtgacaagtgaggatcct
gatgacgggttcaaaccaaccagcggtagagttcaggagttgagttttaagagcaagcca
aatgtgtgggcgtacttctctgtcaagtctggtggaggcatccacgagttctcggattcc
cagtttggacatgtttttgcatttggggaatccagagccctggcgatagcgaatatggtt
cttgggctaaaagaaattcagatccgtggagaaattaggactaacgttgactacacgatc
gaccttttacatgcttctgattaccgtgataacaaaattcacactggttggttggatagt
aggattgctatgcgggtcagagctgagaggcctccatggtatctctctgttgtcggcgga
gctctctataaagcatcagcgaccagtgctgctgtggtttcagattacgttggttatctg
gagaaggggcaaatccctccaaagcatatatctcttgtacattctcaagtgtctctgaat
attgaaggaagtaaatatacgattgatgtagtccggggtggatcaggaacctacaggcta
agaatgaacaagtcagaagtggtagcagaaatacacactctacgtgatggaggtctgttg
atgcagttggatggcaaaagccatgtgatatatgcagaggaagaagctgcaggaactcgt
cttctcattgatggaagaacttgtttgctacagaatgaccacgatccatcaaagttaatg
gctgagacaccgtgcaagttgatgaggtatttgatttccgacaacagcaatattgacgct
gatacgccttatgccgaagttgaggtcatgaagatgtgcatgccacttctttcacctgct
tcaggagttatccattttaaaatgtctgaaggacaagccatgcaggctggtgaacttata
gccaatcttgatcttgatgatccttctgctgtaagaaaggccgaacccttccatggaagt
ttcccaagattagggcttccaactgcaatatccggtagagttcatcagagatgtgccgca
acattaaatgctgcacgcatgattcttgctggctatgagcataaagtagatgaggttgtt
caagacttacttaattgccttgatagccctgaactcccatttcttcagtggcaagagtgc
tttgcagttctggcgacacgactacctaaaaatctcaggaacatgctagaatcaaagtat
agggaatttgagagtatttccagaaactctttgaccaccgatttccctgccaaactttta
aaaggcattcttgaggcacatttatcttcttgtgatgagaaagagagaggtgcccttgaa
aggctcattgaaccattgatgagccttgcaaaatcttatgaaggtggtagagaaagtcat
gcccgtgttattgttcattctctctttgaagaatatctatcagtagaagaattattcaat
gataacatgctggctgatgttatagaacgcatgcgtcagctatacaagaaagatctgttg
aaaattgtggatatagtgctctcacaccagggcataaaaaacaaaaacaaactcgttctc
cggctcatggagcagcttgtttaccctaatcctgctgcttacagagataaacttattcga
ttctcaacacttaaccatactaactactctgagttggcgctcaaggcgagtcaattactt
gaacagaccaaactaagtgagcttcgttcaaacattgctagaagcctttcagagttagaa
atgtttacagaggacggagaaaatatggatactcccaagaggaaaagtgccattaatgaa
agaatagaagatcttgtaagcgcatctttagctgttgaagacgctctcgtgggactattt
gaccatagcgatcacacacttcaaagacgggttgttgagacttatattcgcagattatac
cagccctacgtcgttaaagatagcgtgaggatgcagtggcaccgttctggtcttcttgct
tcctgggagttcctagaggagcatatggaaagaaaaaacattggcttagacgatcccgac
acatctgaaaaaggattggttgagaagcgtagtaagagaaaatggggggctatggttata
atcaaatctttgcagtttcttccaagtataataagtgcagcattgagagaaacaaagcac
aacgactatgaaactgccggagctcctttatctggcaatatgatgcacattgctattgtg
ggcatcaacaaccagatgagtctgcttcaggacagtggggatgaagaccaagctcaggaa
agagtaaacaagttggccaaaattcttaaagaggaagaagtgagttcaagcctctgttct
gccggtgttggtgtaatcagctgtataattcagcgagatgaaggacgaacacccatgaga
cattctttccattggtcgttggagaaacagtattatgtagaagagccgttgctgcgtcat
cttgaacctcctctgtccatttaccttgagttggataagctgaaaggatactcaaatata
caatatacgccttctcgagatcgtcaatggcatctgtatactgttacagacaagccagtg
ccaatcaagaggatgttcctgagatctcttgttcgacaggctacaatgaacgatggattt
atattgcagcaagggcaggataagcagcttagccaaacactgatctccatggcgtttacg
tcgaaatgtgttctgaggtctttgatggatgccatggaggaactggaactgaatgcccat
aatgctgcaatgaaaccagatcacgcacatatgtttctttgcatattgcgtgagcagcag
atagatgatcttgtgcctttccccaggagagttgaagtgaatgcggaggatgaagaaact
acagttgaaatgatcttagaagaagcagcacgagagatacatagatctgttggagtgaga
atgcataggttgggcgtgtgcgagtgggaagtgcggctgtggttggtgtcctctggactg
gcatgtggtgcttggagggttgtggttgcaaacgtgacaggccgtacatgcactgtccac
atataccgagaagttgaaactcctggaagaaacagtttaatctaccactcaataaccaag
aagggacctttgcatgaaacaccaatcagtgatcaatataagcccctgggatatctcgac
aggcaacgtttagcagcaaggaggagtaacactacttattgctatgacttcccgttggca
tttgggacagccttggaactgttgtgggcatcacaacacccaggagttaagaaaccatat
aaggatactctgatcaatgttaaagagcttgtattctcaaaaccagaaggttcttcgggt
acatctctagatctggttgaaagaccacccggtctcaacgactttggaatggttgcctgg
tgcctagatatgtcgaccccagagtttcctatggggcggaaacttctcgtgattgcgaat
gatgtcaccttcaaagctggttcttttggtcctagagaggacgcgtttttccttgctgtt
actgaactcgcttgtgccaagaagcttcccttgatttacttggcagcaaattctggtgcc
cgacttggggttgctgaagaagtcaaagcctgcttcaaagttggatggtcggatgaaatt
tcccctgagaatggttttcagtatatatacctaagccctgaagaccacgaaaggattgga
tcatctgtcattgcccatgaagtaaagctctctagtggggaaactaggtgggtgattgat
acgatcgttggcaaagaagatggtattggtgtagagaacttaacaggaagtggggccata
gcgggtgcttactcaaaggcatacaatgaaacttttactttaacctttgttagtggaaga
acggttggaattggtgcttatcttgcccgcctaggtatgcggtgcatacagagacttgat
cagccgatcatcttgactggcttctctacactcaacaagttacttgggcgtgaggtctat
agctctcacatgcaactgggtggcccgaaaatcatgggcacaaatggtgttgttcatctt
acagtctcagatgatcttgaaggcgtatcagcaattctcaactggctcagctacattcct
gcttacgtgggtggtcctcttcctgttcttgcccctttagatccaccggagagaattgtg
gagtatgtcccagagaactcttgcgacccacgagcggctatagctggggtcaaagacaat
accggtaaatggcttggaggtatctttgataaaaatagtttcattgagactcttgaaggc
tgggcaaggacggtagtgactggtagagccaagctcgggggaatacccgttggagttgtt
gcagttgagacacagactgtcatgcagatcatcccagccgatcctggacagcttgactct
catgaaagagtggttccgcaagcagggcaagtctggtttcctgattcagcggccaagact
gctcaagcgcttatggatttcaaccgggaagagcttccattgtttatcctagcgaactgg
agagggttttcaggtgggcagagagatcttttcgaaggaatacttcaggcaggttcaact
atagtagaaaatctgagaacctatcgtcagccagtgtttgtgtacatcccaatgatggga
gagctgcgcggtggagcgtgggttgttgttgacagccagataaattcggattatgttgaa
atgtatgctgatgaaacagctcgtggaaatgtgcttgagccagaagggacaatagagata
aaatttagaacaaaagagctattagagtgcatgggaaggttggaccagaagctaatcagt
ctgaaagcaaaactgcaagatgccaagcaaagcgaggcctatgcaaacatcgagcttctc
cagcaacagattaaagcccgagagaaacagcttttaccagtttatatccaaatcgccacc
aaatttgcagaacttcatgacacttccatgagaatggctgcaaagggagtgatcaaaagt
gttgtggaatggagcggctcgcggtccttcttctacaaaaagctcaataggagaatcgct
gagagctctcttgtgaaaaacgtaagagaagcatctggagacaacttagcatataaatct
tcaatgcgtctgattcaggattggttctgcaactctgatattgcaaaggggaaagaagaa
gcttggacagacgaccaagtgttctttacatggaaggacaatgttagtaactacgagttg
aagctgagcgagttgagagcgcagaaactactgaaccaacttgcagagattgggaattcc
tcagatttgcaagctctgccacaaggacttgctaatcttctaaacaaggtggagccgtcg
aaaagagaagagctggtggctgctattcgaaaggtcttgggttga

DBGET integrated database retrieval system