KEGG   Arabidopsis thaliana (thale cress): AT1G43670Help
Entry
AT1G43670         CDS       T00041                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase
  KO
K03841  
fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT1G43670
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT1G43670
   00030 Pentose phosphate pathway
    AT1G43670
   00051 Fructose and mannose metabolism
    AT1G43670
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AT1G43670
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     AT1G43670
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT1G43670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 341 aa AA seqDB search
MDHAADAHRTDLMTITRFVLNEQSKYPESRGDFTILLSHIVLGCKFVCSAVNKAGLAKLI
GLAGETNIQGEEQKKLDVLSNDVFVNALVSSGRTSVLVSEEDEEATFVEPSKRGKYCVVF
DPLDGSSNIDCGVSIGTIFGIYTLDHTDEPTTADVLKPGNEMVAAGYCMYGSSCMLVLST
GTGVHGFTLDPSLGEFILTHPDIKIPNKGNIYSVNEGNAQNWDGPTTKYVEKCKFPKDGS
PAKSLRYVGSMVADVHRTLLYGGIFLYPADKKSPNGKLRVLYEVFPMSFLMEQAGGQAFT
GKKRALDLVPEKIHERSPIFLGSYDDVEEIKALYAEEEKKN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgcagcagatgctcaccgtacggatttgatgaccattacaagattcgtgttg
aatgaacaatcaaagtatccagaatctcgtggtgatttcaccattttgcttagtcacatc
gttttgggttgcaaattcgtttgcagtgctgttaataaggctggtttggctaagttaatt
ggacttgcaggggaaacaaacattcagggtgaagagcaaaagaaacttgatgtgctctct
aatgatgtctttgtcaacgctttggttagcagtggtagaacttctgttcttgtctcggag
gaagatgaggaagctacgtttgtggagccatccaagcgtggaaagtactgtgttgttttt
gatccgcttgatggatcttcaaacattgactgtggtgtttccattggcacaatttttgga
atttacacgttggaccacactgatgagccaaccactgcagatgttctgaaacctgggaat
gaaatggtggctgcaggttattgtatgtacggaagctcctgcatgcttgtgttgagcact
ggaaccggtgtccacggatttacactggacccatctctaggagagttcattctaactcac
ccggacattaagattccaaataagggaaacatttattcggtgaatgaaggcaatgcgcag
aactgggatggtccaactacaaagtatgtagagaaatgcaagtttcctaaagatggttct
cctgcaaagtctctgagatacgtaggaagtatggtagctgatgttcatcgtacactactt
tatggaggaatcttcttgtacccggctgacaagaaaagccccaatggaaaattgcgtgtc
ttgtatgaagttttcccgatgtcgtttttgatggagcaagccggaggtcaggcctttacg
ggaaagaaaagggcgctagaccttgtcccggagaagatccatgagcgttctccgatattt
cttggtagctacgatgatgtagaagagattaaagctctctatgctgaggaggaaaagaag
aactaa

DBGET integrated database retrieval system