KEGG   Arabidopsis thaliana (thale cress): AT1G43980Help
Entry
AT1G43980         CDS       T00041                                 

Definition
(RefSeq) pentatricopeptide repeat-containing protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 621 aa AA seqDB search
MPSSLYFSRLVNRSLLSKSPTLAKIVHAQLLEAGFVRTTYWGNRCLQLYFKSGSVINALQ
LFDDIPDKNTITWNVCLKGLFKNGYLNNALDLFDEMPERDVVSWNTMISGLVSCGFHEYG
IRVFFDMQRWEIRPTEFTFSILASLVTCVRHGEQIHGNAICSGVSRYNLVVWNSVMDMYR
RLGVFDYALSVFLTMEDRDVVSWNCLILSCSDSGNKEVALDQFWLMREMEIQPDEYTVSM
VVSICSDLRELSKGKQALALCIKMGFLSNSIVLGAGIDMFSKCNRLDDSVKLFRELEKWD
SVLCNSMIGSYSWHCCGEDALRLFILAMTQSVRPDKFTFSSVLSSMNAVMLDHGADVHSL
VIKLGFDLDTAVATSLMEMYFKTGSVDLAMGVFAKTDGKDLIFWNTVIMGLARNSRAVES
LAIFNQLLMNQSLKPDRVTLMGILVACCYAGFVNEGIQIFSSMEKAHGVNPGNEHYACII
ELLCRVGMINEAKDIADKIPFEPSSHIWEPILCASLDLGDTRLAETVAKTMLESEPKSSF
PYLVLIKIYEMTWRWENSVKLRYAMNEHKLKSAQGSSKISIESSVFSFEADQLQIHGGHD
TCALLDLLSWDSFDQKIHWSA
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcctctctctacttctcgcgtctcgtaaaccgctctttactctcaaagtctcca
actttagccaaaatcgtccatgcccagctcctggaagctggattcgtacgcactacttat
tggggaaatcgctgccttcagctctacttcaaatccggatccgtcatcaatgccctccaa
ctgttcgacgatattcctgataagaacaccataacctggaacgtttgcttaaagggtttg
tttaaaaatggttatctcaataacgcacttgacctgttcgacgaaatgcctgaacgagat
gttgttagctggaatacaatgatttcagggttggtttcttgtgggtttcatgaatatggg
attagggttttcttcgatatgcagagatgggagattagaccaacggagtttactttttcg
attctagcttctcttgttacttgtgttcgacatggggaacagattcatggtaatgctatt
tgtagtggtgtgagtaggtataatttggttgtgtggaactctgttatggatatgtataga
agattaggagtttttgattacgcgttatcggtgtttttaactatggaggatagagatgtt
gtctcgtggaactgtttgattttgtcttgttccgattctggtaataaggaagtggctttg
gatcagttttggttgatgagagaaatggagattcaacctgatgaatatacagtttcgatg
gttgtgtctatttgctctgatttacgagaactgagtaagggtaagcaggctcttgctctt
tgtatcaagatggggtttttatctaacagtattgttttaggagctgggattgatatgttt
tccaaatgtaacagattggatgattcggttaaactttttagagagttggagaaatgggat
tcagtgttgtgcaattccatgatcggtagctattcgtggcattgttgtggagaagatgct
cttcggctctttatccttgccatgacgcagagtgttaggcctgataagttcacgttcagt
agcgttctgagctcaatgaatgctgtgatgctagatcacggagcagacgttcattctttg
gttattaagttagggtttgatttggatacggcagtagctacctcactcatggagatgtac
ttcaaaaccggttcagttgatttagcaatgggagtgtttgccaaaacagatggaaaagat
ttgatcttttggaacacagtgataatgggcttggcgagaaacagtagagcagttgagtcc
cttgccattttcaatcaattgctgatgaaccaaagtctgaaacccgatagagtgacgtta
atgggtatcttagtagcttgttgttatgctggctttgttaatgaaggaattcagatattc
tcttcaatggaaaaggctcatggagttaatcccgggaacgagcattacgcctgtataatc
gaattgctttgcagagtcggtatgatcaatgaagcaaaggacattgctgacaagatacct
tttgaaccaagctctcatatctgggaaccgattctctgtgcatctcttgatcttggagac
acaagactcgctgagactgtagcgaaaactatgttagaatctgaaccaaagtcatctttt
ccttacctggttctgattaagatatacgagatgacatggcgctgggaaaattcagtgaag
ttaagatacgccatgaatgaacataagttgaaatcggctcaaggatcgagcaagatcagt
atagagagcagtgtgttcagcttcgaggctgaccagttgcaaattcatggaggtcatgat
acttgcgcactcttggacttattgtcttgggattcttttgatcagaaaattcattggtct
gcataa

DBGET integrated database retrieval system