KEGG   Arabidopsis thaliana (thale cress): AT1G45145Help
Entry
AT1G45145         CDS       T00041                                 

Gene name
TRX5
Definition
(RefSeq) thioredoxin H5
  KO
K03671  
thioredoxin 1
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Chaperones and folding catalysts [BR:ath03110]
 Protein folding catalysts
  Protein disulfide isomerase
   AT1G45145 (TRX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 118 aa AA seqDB search
MAGEGEVIACHTLEVWNEKVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFTNVV
FFKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKHGGLVASA
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgaaggagaagtgattgcttgccataccctcgaagtttggaacgagaaggtc
aaagacgccaatgaatccaagaaactgattgtgatagacttcacagcatcatggtgtcca
ccttgccgtttcattgcaccagtgtttgcagagatggctaagaagttcactaatgttgtc
ttcttcaagatcgatgttgatgaattgcaagctgttgctcaggaattcaaagttgaggca
atgcctacttttgttttcatgaaagaaggcaacatcattgatcgtgttgtcggtgctgcg
aaagatgagatcaatgagaagctgatgaagcatggtggtcttgtagcttctgcttga

DBGET integrated database retrieval system