KEGG   Arabidopsis thaliana (thale cress): AT1G45191Help
Entry
AT1G45191         CDS       T00041                                 

Gene name
BGLU1
Definition
(RefSeq) Glycosyl hydrolase superfamily protein
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00460  Cyanoamino acid metabolism
ath00500  Starch and sucrose metabolism
ath00940  Phenylpropanoid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT1G45191 (BGLU1)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AT1G45191 (BGLU1)
  Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT1G45191 (BGLU1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     AT1G45191 (BGLU1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 841088
NCBI-ProteinID: NP_001323174
MIPS: AT1G45191.1
TAIR: AT1G45191
Araport: AT1G45191
UniProt: Q3ECW8
Position
1
AA seq 517 aa AA seqDB search
MEDVLTLITMIVLLLLAFHGFGKCSSDLYSRSDFPEGFVFGAGISAYQWEGAVDEDGRKP
SVWDTFLHCRKMDNGDIACDGYHKYKEDVQLMAETGLHTFRFSISWSRLISNGRGSINPK
GLQFYKNFIQELVKHGIEPHVTLHHYDFPQYLEDDYGGWTNRKIIKDFTAYADVCFREFG
NHVKFWTTINEANIFTIGGYNDGNSPPGRCSFPGRNCTLGNSSTETYIVGHNLLLAHASV
SRLYKQKYKDIQGGSVGFSLFAMNFTPSTNSKDDEIATKRANDFYLGWMLEPLIYGDYPD
VMKRTIGSRLPVFSKEESEQVKGSSDFIGVIHYLTALVTNIDINPSLSGIPDFNSDMGES
INILSMRVRISRLPNSDEKCLIFFITLSILEYIKQSYGNPPVYILENGKTMNQDLELQQK
DTPRIEYLDAYIGAVLKAVRNGSDTRGYFVWSFMDLYELLNGYKSSFGLYSVNFSDPHRK
RSPKLSAHWYSGFLKGKPTFLGSQGITQLHSNFSSSR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgttttgactctcattaccatgattgtgttgcttcttctagctttccatgga
tttggaaaatgcagtagcgatctttacagcaggagcgatttcccggaaggcttcgttttc
ggagccgggatatctgcttatcagtgggaaggagctgttgatgaagatgggaggaaacct
agcgtctgggatactttccttcactgtcgtaaaatggataatggagacatagcttgtgat
ggatatcacaagtataaggaagatgtgcagctcatggccgaaactggcttacatacattc
agattctccatctcttggtctagactcatctctaatggaagaggttccattaacccgaaa
ggtctacagttctacaagaatttcattcaagaacttgtcaaacatggaattgagccacat
gttacactacatcactacgattttcctcaatatctcgaggatgactatggaggctggacc
aaccgcaaaatcatcaaagactttaccgcttatgcagatgtttgctttagagagtttggg
aaccacgtcaaattctggaccacgatcaacgaggctaatatatttactattggaggttac
aacgatgggaattcaccgcctggtcgttgctcctttccgggcagaaactgcacgttaggg
aactcttccactgaaacatatatcgtaggccataacttgctgcttgctcacgcctctgtt
tcaagactatataagcaaaagtacaaggatatacaaggaggttctgttggatttagttta
tttgcaatgaattttactccttctacaaactccaaggatgatgaaatcgcaacgaaaaga
gccaacgatttctacctcggatggatgcttgagcctcttatatatggagactatcctgat
gtgatgaaaagaaccattggatcaagactgccagttttctcgaaggaagaatcagaacaa
gtgaaaggctcatctgacttcataggagtcattcactatctcacggctttggtcacaaac
atcgatatcaacccttcactttcaggaattccagattttaactcagacatgggtgaatct
attaatattttatctatgagggtaagaatttcaaggctaccaaattcagatgaaaagtgc
ctaatattctttataactttaagcatcctagagtatataaagcagagctatggcaatcct
ccagtctacattcttgagaatggtaaaacaatgaaccaagatttggagctgcaacaaaag
gacacaccaaggattgagtacttagatgcttacattggtgcggtgctcaaagctgttagg
aatggatcagacacgagaggctacttcgtatggtcatttatggatttgtacgaattacta
aacggatacaagagtagttttggattgtactctgtcaatttcagtgatccccatcgcaag
agatctcccaaactctctgctcactggtactctggttttctcaagggcaaacccacattt
cttggttcccaaggcatcacacaattgcatagcaacttctcttcttccagatag

DBGET integrated database retrieval system