KEGG   Arabidopsis thaliana (thale cress): AT1G45191Help
Entry
AT1G45191         CDS       T00041                                 

Definition
(RefSeq) beta-glucosidase 1
  KO
K01188  
beta-glucosidase [EC:3.2.1.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Cyanoamino acid metabolism
Starch and sucrose metabolism
Phenylpropanoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT1G45191
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AT1G45191
  Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT1G45191
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     AT1G45191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 512 aa AA seqDB search
MEDVLTLITMIVLLLLAFHGFGKCSSDLYSRSDFPEGFVFGAGISAYQWEGAVDEDGRKP
SVWDTFLHCRKMDNGDIACDGYHKYKEDVQLMAETGLHTFRFSISWSRLISNGRGSINPK
GLQFYKNFIQELVKHGIEPHVTLHHYDFPQYLEDDYGGWTNRKIIKDFTAYADVCFREFG
NHVKFWTTINEANIFTIGGYNDGNSPPGRCSFPGRNCTLGNSSTETYIVGHNLLLAHASV
SRLYKQKYKDIQGGSVGFSLFAMNFTPSTNSKDDEIATKRANDFYLGWMLEPLIYGDYPD
VMKRTIGSRLPVFSKEESEQVKGSSDFIGVIHYLTALVTNIDINPSLSGIPDFNSDMVLS
MRVRISRLPNSDEKCLIFFITLSILEYIKQSYGNPPVYILENGKTMNQDLELQQKDTPRI
EYLDAYIGAVLKAVRNGSDTRGYFVWSFMDLYELLNGYKSSFGLYSVNFSDPHRKRSPKL
SAHWYSGFLKGKPTFLGSQGITQLHSNFSSSR
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgttttgactctcattaccatgattgtgttgcttcttctagctttccatgga
tttggaaaatgcagtagcgatctttacagcaggagcgatttcccggaaggcttcgttttc
ggagccgggatatctgcttatcagtgggaaggagctgttgatgaagatgggaggaaacct
agcgtctgggatactttccttcactgtcgtaaaatggataatggagacatagcttgtgat
ggatatcacaagtataaggaagatgtgcagctcatggccgaaactggcttacatacattc
agattctccatctcttggtctagactcatctctaatggaagaggttccattaacccgaaa
ggtctacagttctacaagaatttcattcaagaacttgtcaaacatggaattgagccacat
gttacactacatcactacgattttcctcaatatctcgaggatgactatggaggctggacc
aaccgcaaaatcatcaaagactttaccgcttatgcagatgtttgctttagagagtttggg
aaccacgtcaaattctggaccacgatcaacgaggctaatatatttactattggaggttac
aacgatgggaattcaccgcctggtcgttgctcctttccgggcagaaactgcacgttaggg
aactcttccactgaaacatatatcgtaggccataacttgctgcttgctcacgcctctgtt
tcaagactatataagcaaaagtacaaggatatacaaggaggttctgttggatttagttta
tttgcaatgaattttactccttctacaaactccaaggatgatgaaatcgcaacgaaaaga
gccaacgatttctacctcggatggatgcttgagcctcttatatatggagactatcctgat
gtgatgaaaagaaccattggatcaagactgccagttttctcgaaggaagaatcagaacaa
gtgaaaggctcatctgacttcataggagtcattcactatctcacggctttggtcacaaac
atcgatatcaacccttcactttcaggaattccagattttaactcagacatggttttatct
atgagggtaagaatttcaaggctaccaaattcagatgaaaagtgcctaatattctttata
actttaagcatcctagagtatataaagcagagctatggcaatcctccagtctacattctt
gagaatggtaaaacaatgaaccaagatttggagctgcaacaaaaggacacaccaaggatt
gagtacttagatgcttacattggtgcggtgctcaaagctgttaggaatggatcagacacg
agaggctacttcgtatggtcatttatggatttgtacgaattactaaacggatacaagagt
agttttggattgtactctgtcaatttcagtgatccccatcgcaagagatctcccaaactc
tctgctcactggtactctggttttctcaagggcaaacccacatttcttggttcccaaggc
atcacacaattgcatagcaacttctcttcttccagatag

DBGET integrated database retrieval system