KEGG   Arabidopsis thaliana (thale cress): AT1G47760Help
Entry
AT1G47760         CDS       T00041                                 

Gene name
AGL102
Definition
(RefSeq) protein agamous-like 102
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 184 aa AA seqDB search
MGRRKIEIKFIEDSIERKATFSRRRNGIFKKADELAKLCNVEIAVLVISPTNIPYTYGYP
CFNDVVERIQNPSASSKLRSLMKELEQIKEFQEDLRKKQQRNLEKSNMKENVDLKLEDLV
AFKAKLEAYQAGLKRKHVEMEDLSSPSILSKNTKNKMMRTEYSSGQSKGMYEFRAFGPGF
LGTI
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtagaaaaatagagataaaatttattgaagatagcatcgaaaggaaagcgacg
ttttcaagacgccgaaatggcatttttaagaaggctgatgaactcgcgaagttgtgtaat
gtagagattgctgtcttggtcatctcccccactaatataccatacacatacggttatcca
tgcttcaacgatgtggttgagcgtattcaaaatcctagtgcttcgtccaaactcaggagt
ctcatgaaagaattggaacaaatcaaagagtttcaggaggatttgaggaagaaacagcaa
agaaaccttgaaaagtccaatatgaaagagaatgtagatctgaaattggaggacttagtt
gctttcaaggcgaaactcgaggcctatcaagcaggtttaaagaggaaacatgtagagatg
gaggatttgtcttctccatcgatactctcaaagaatacaaagaataagatgatgaggacc
gagtattcgtctggacagagcaaaggaatgtatgagtttcgggctttcggcccaggattt
cttggaactatttag

DBGET integrated database retrieval system