KEGG   Arabidopsis thaliana (thale cress): AT1G48030Help
Entry
AT1G48030         CDS       T00041                                 

Gene name
mtLPD1
Definition
(RefSeq) dihydrolipoyl dehydrogenase 1
  KO
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Leucine degradation, leucine => acetoacetate + acetyl-CoA
Pyruvate oxidation, pyruvate => acetyl-CoA
Photorespiration
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT1G48030 (mtLPD1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT1G48030 (mtLPD1)
   00020 Citrate cycle (TCA cycle)
    AT1G48030 (mtLPD1)
   00620 Pyruvate metabolism
    AT1G48030 (mtLPD1)
   00630 Glyoxylate and dicarboxylate metabolism
    AT1G48030 (mtLPD1)
   00640 Propanoate metabolism
    AT1G48030 (mtLPD1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT1G48030 (mtLPD1)
   00280 Valine, leucine and isoleucine degradation
    AT1G48030 (mtLPD1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     AT1G48030 (mtLPD1)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AT1G48030 (mtLPD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 507 aa AA seqDB search
MAMASLARRKAYFLTRNLSNSPTDALRFSFSLSRGFASSGSDENDVVIIGGGPGGYVAAI
KASQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAKHSFANHGIKVSSVEVD
LPAMLAQKDNAVKNLTRGIEGLFKKNKVTYVKGYGKFISPNEVSVETIDGGNTIVKGKHI
IVATGSDVKSLPGITIDEKKIVSSTGALSLSEVPKKLIVIGAGYIGLEMGSVWGRLGSEV
TVVEFAGDIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVSVDSSSDGVKLTVEPAEGGEQ
SILEADVVLVSAGRTPFTSGLDLEKIGVETDKAGRILVNDRFLSNVPGVYAIGDVIPGPM
LAHKAEEDGVACVEFIAGKHGHVDYDKVPGVVYTHPEVASVGKTEEQLKKEGVSYRVGKF
PFMANSRAKAIDNAEGLVKILADKETDKILGVHIMAPNAGELIHEAVLAINYDASSEDIA
RVCHAHPTMSEALKEAAMATYDKPIHI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggcgagtttagctaggaggaaggcgtattttctcaccagaaacttatcaaac
tctcccactgacgctctcagattctccttttccctctcccgtggcttcgcctcatcagga
tctgatgaaaacgacgtcgtcatcatcggcggcggtcccggtggttacgtagccgcgatc
aaagcctctcagcttggtctcaaaaccacttgtatcgagaaacgcggcgctctcggtggt
acttgtctcaacgtcggttgcattccttccaaggctctgcttcactcttcacatatgtac
catgaggcgaagcattccttcgctaaccatggtattaaggtctcttctgttgaggtagat
cttcctgctatgttggctcagaaagataatgcggttaagaacctcactcgtggtattgag
ggtttgttcaagaaaaataaggtgacttatgtcaaaggatatggtaagtttatttcccca
aatgaagtctcggtggagactattgatggaggaaacactattgtgaaaggtaaacatatc
attgttgctactggctcggatgttaagtccttgcctggtattacgattgatgaaaagaag
attgtttcgtcgactggagcgttgtctctatcggaagttccgaagaaattgattgttatt
ggtgcggggtatattgggcttgagatgggttctgtttggggtaggcttggatctgaggtt
acggttgttgagtttgctggagatattgttccttcgatggatggtgaaattcgtaagcag
tttcaacgttctcttgagaagcagaagatgaagttcatgctcaagactaaagttgtttct
gtggattcctcctctgatggtgtgaagcttacagtggaaccggcagaaggaggagagcag
tctattctggaagctgatgtggtacttgtctcagcgggaagaacaccgttcacttctgga
cttgatctggagaaaatcggagtggaaactgacaaagccgggaggattctggtgaatgat
agattcttgagtaatgtcccaggcgtgtatgctattggagatgtgattccaggaccaatg
cttgctcacaaagccgaagaagacggtgttgcttgtgtggagttcatagcaggcaaacac
ggtcatgttgattatgacaaggttcctggtgttgtttacactcatcctgaggttgcttcg
gttggtaaaaccgaagaacagctgaagaaagaaggtgtgagttaccgggttgggaaattc
ccgtttatggcgaatagcagagctaaggctattgataatgcagaaggattggttaagatt
ctggccgataaggagactgataagatcttgggcgttcacattatggcgccaaacgctgga
gagctgattcatgaggctgttcttgcgattaactacgatgcatcaagtgaagacattgct
cgagtctgccatgctcatcccactatgagcgaggctcttaaggaagctgccatggccacc
tatgacaagcctattcacatctaa

DBGET integrated database retrieval system