KEGG   Arabidopsis thaliana (thale cress): AT1G48030Help
Entry
AT1G48030         CDS       T00041                                 

Gene name
mtLPD1
Definition
(RefSeq) mitochondrial lipoamide dehydrogenase 1
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00020  Citrate cycle (TCA cycle)
ath00260  Glycine, serine and threonine metabolism
ath00280  Valine, leucine and isoleucine degradation
ath00620  Pyruvate metabolism
ath00630  Glyoxylate and dicarboxylate metabolism
ath00640  Propanoate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Module
ath_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
ath_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
ath_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT1G48030 (mtLPD1)
   00020 Citrate cycle (TCA cycle)
    AT1G48030 (mtLPD1)
   00620 Pyruvate metabolism
    AT1G48030 (mtLPD1)
   00630 Glyoxylate and dicarboxylate metabolism
    AT1G48030 (mtLPD1)
   00640 Propanoate metabolism
    AT1G48030 (mtLPD1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT1G48030 (mtLPD1)
   00280 Valine, leucine and isoleucine degradation
    AT1G48030 (mtLPD1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     AT1G48030 (mtLPD1)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AT1G48030 (mtLPD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_oxidored FAD_binding_2 NAD_binding_8 AlaDh_PNT_C Thi4 3HCDH_N HI0933_like FAD_binding_3 K_oxygenase Lycopene_cycl UDPG_MGDP_dh_N DAO
Motif
Other DBs
NCBI-GeneID: 841221
NCBI-ProteinID: NP_001322048
MIPS: AT1G48030.1
TAIR: AT1G48030
Araport: AT1G48030
UniProt: Q9M5K3 A0A178W162
Position
1
AA seq 507 aa AA seqDB search
MAMASLARRKAYFLTRNLSNSPTDALRFSFSLSRGFASSGSDENDVVIIGGGPGGYVAAI
KASQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAKHSFANHGIKVSSVEVD
LPAMLAQKDNAVKNLTRGIEGLFKKNKVTYVKGYGKFISPNEVSVETIDGGNTIVKGKHI
IVATGSDVKSLPGITIDEKKIVSSTGALSLSEVPKKLIVIGAGYIGLEMGSVWGRLGSEV
TVVEFAGDIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVSVDSSSDGVKLTVEPAEGGEQ
SILEADVVLVSAGRTPFTSGLDLEKIGVETDKAGRILVNDRFLSNVPGVYAIGDVIPGPM
LAHKAEEDGVACVEFIAGKHGHVDYDKVPGVVYTHPEVASVGKTEEQLKKEGVSYRVGKF
PFMANSRAKAIDNAEGLVKILADKETDKILGVHIMAPNAGELIHEAVLAINYDASSEDIA
RVCHAHPTMSEALKEAAMATYDKPIHI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggcgagtttagctaggaggaaggcgtattttctcaccagaaacttatcaaac
tctcccactgacgctctcagattctccttttccctctcccgtggcttcgcctcatcagga
tctgatgaaaacgacgtcgtcatcatcggcggcggtcccggtggttacgtagccgcgatc
aaagcctctcagcttggtctcaaaaccacttgtatcgagaaacgcggcgctctcggtggt
acttgtctcaacgtcggttgcattccttccaaggctctgcttcactcttcacatatgtac
catgaggcgaagcattccttcgctaaccatggtattaaggtctcttctgttgaggtagat
cttcctgctatgttggctcagaaagataatgcggttaagaacctcactcgtggtattgag
ggtttgttcaagaaaaataaggtgacttatgtcaaaggatatggtaagtttatttcccca
aatgaagtctcggtggagactattgatggaggaaacactattgtgaaaggtaaacatatc
attgttgctactggctcggatgttaagtccttgcctggtattacgattgatgaaaagaag
attgtttcgtcgactggagcgttgtctctatcggaagttccgaagaaattgattgttatt
ggtgcggggtatattgggcttgagatgggttctgtttggggtaggcttggatctgaggtt
acggttgttgagtttgctggagatattgttccttcgatggatggtgaaattcgtaagcag
tttcaacgttctcttgagaagcagaagatgaagttcatgctcaagactaaagttgtttct
gtggattcctcctctgatggtgtgaagcttacagtggaaccggcagaaggaggagagcag
tctattctggaagctgatgtggtacttgtctcagcgggaagaacaccgttcacttctgga
cttgatctggagaaaatcggagtggaaactgacaaagccgggaggattctggtgaatgat
agattcttgagtaatgtcccaggcgtgtatgctattggagatgtgattccaggaccaatg
cttgctcacaaagccgaagaagacggtgttgcttgtgtggagttcatagcaggcaaacac
ggtcatgttgattatgacaaggttcctggtgttgtttacactcatcctgaggttgcttcg
gttggtaaaaccgaagaacagctgaagaaagaaggtgtgagttaccgggttgggaaattc
ccgtttatggcgaatagcagagctaaggctattgataatgcagaaggattggttaagatt
ctggccgataaggagactgataagatcttgggcgttcacattatggcgccaaacgctgga
gagctgattcatgaggctgttcttgcgattaactacgatgcatcaagtgaagacattgct
cgagtctgccatgctcatcccactatgagcgaggctcttaaggaagctgccatggccacc
tatgacaagcctattcacatctaa

DBGET integrated database retrieval system