KEGG   Arabidopsis thaliana (thale cress): AT1G48790Help
Entry
AT1G48790         CDS       T00041                                 

Gene name
AMSH1
Definition
AMSH-like ubiquitin thioesterase 1
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ath00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    AT1G48790 (AMSH1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AT1G48790 (AMSH1)
Peptidases [BR:ath01002]
 Metallo Peptidases
  Family M67
   AT1G48790 (AMSH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 507 aa AA seqDB search
MGSSFETIDIATSARRIGVDNRISLKFYFRIADNILKQANIFRAEKNVIDLYVMLLRFSS
LALETIPSHRDYRTSLKSNKEYLRMRLLDVLTELEKLKPVVQQRIDELYPKLKPRYNVQA
HPANGSLGWSSAVKPSFNSYDHAKVRNPPGHNSGYMGSRGQQFLNAAPLEERFRKMSVNF
RPNEETLSKHSILGPGGLSAQWQPPKYDTKVQYPSNIDFSPVVIPSFQQLVDSKPMITNG
SNDEPEKPIVEPSVASNEKIQKNYTEELSSMISFEEPESVNENNLIRQPSPPPVLAEVQD
LVPALCPEVREPECMIENSLPDESLRSESPLELHIATSMMDTFMRLAKSNTKKNLETCGI
LAGSLKNRKFYITALIIPKQESTSDSCQATNEEEIFEVQDKQSLFPLGWIHTHPTQSCFM
SSIDVHTHYSYQIMLPEAVAIVMAPQDSSRNHGIFRLTTPGGMTVIRNCDRRGFHAHSSP
EDGGPIYNTCKEVYMNPNLKFDVIDLR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgtcttttgagaccatcgatatcgctaccagtgctcggagaattggcgtagat
aatcgtatttctctcaaattttacttcaggatcgctgataatatcctcaaacaggccaac
atatttcgggcagagaagaatgttattgatttatatgtcatgcttctgcggttttcaagc
ttggctctcgagactataccgtcccatcgagattacagaacatctctaaaaagcaataaa
gagtatttgagaatgagactactagatgtcttgacggagctggagaagttgaaaccagtt
gtacagcaaaggattgatgaactgtatcccaagctcaaacctcgatataacgttcaagct
catccagcaaatggttccctaggctggtcttctgccgtgaaaccgtcatttaatagctat
gatcatgcaaaggtaagaaatcctcctggacataattctggctacatgggttccaggggt
cagcaatttttgaacgctgcaccacttgaagagcgtttccgaaagatgtcggtgaacttc
cgaccaaatgaagaaaccctttccaagcattctatcttgggtccaggtggactctctgca
cagtggcagccaccaaagtatgatacaaaggttcaatatccaagcaatatagatttttcg
cctgttgtaatcccaagcttccaacaacttgtggacagcaaaccaatgataacgaatggc
agtaacgatgaacctgaaaagccaattgtggaacccagtgttgcatctaatgaaaaaatc
cagaaaaattacactgaagagctttcttccatgatttctttcgaagagccagaaagcgtt
aatgagaacaatctcattaggcaaccttcaccacctccagtgctagcagaagttcaagac
ttggttcctgctttatgtcctgaagttagagaaccggaatgtatgatagaaaactctctg
ccggatgagtctctacggtcggagtctcctcttgaacttcatattgcgacttcaatgatg
gatacctttatgaggcttgccaagtcaaacactaaaaagaatttagagacgtgtggtatt
cttgccggttcactaaaaaacagaaaattttacattacagctctcatcataccaaagcag
gaatcgacatctgactcgtgtcaggccacgaacgaagaagagatatttgaagtacaggac
aagcaatcccttttcccactcggatggattcatacgcatccgacacagtcttgtttcatg
tcatccattgatgttcacacacactattcataccagattatgttaccagaagctgtggca
atcgttatggcgccacaagactcttcaaggaatcacggaatatttcggctgacgacgccg
ggaggaatgacggtgataaggaattgtgaccggcgtgggtttcatgcgcacagttcaccg
gaggacggagggccaatttacaatacctgtaaggaagtttacatgaacccaaatctcaag
tttgatgtcattgatctcagatag

DBGET integrated database retrieval system