KEGG   Arabidopsis thaliana (thale cress): AT1G49710Help
Entry
AT1G49710         CDS       T00041                                 

Gene name
FUT12
Definition
fucosyltransferase 12
Orthology
K00753  
glycoprotein 3-alpha-L-fucosyltransferase [EC:2.4.1.214]
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 513 aa AA seqDB search
MGVFSNLRGPRAGATHDEFPATNGSPSSSSSPSSSIKRKLSNLLPLCVALVVIAEIGFLG
RLDKVALVDTLTDFFTQSPSLSQSPPARSDRKKIGLFTDRSCEEWLMREDSVTYSRDFTK
DPIFISGGEKDFQWCSVDCTFGDSSGKTPDAAFGLGQKPGTLSIIRSMESAQYYPENDLA
QARRRGYDIVMTTSLSSDVPVGYFSWAEYDIMSPVQPKTERAIAAAFISNCGARNFRLQA
LEALMKTNIKIDSYGGCHRNRDGKVDKVEALKRYKFSLAFENTNEEDYVTEKFFQSLVAG
SVPVVVGPPNIEEFAPASDSFLHIKTMEDVEPVAKRMKYLAANPAAYNQTLRWKYEGPSD
SFKALVDMAAVHSSCRLCIFLATRVREQEEESPNFKKRPCKCSRGGSDTVYHVFVRERGR
FEMESVFLRGKSVTQEALESAVLAKFKSLKHEAVWKKERPGNLKGDKELKIHRIYPLGLT
QRQALYNFKFEGNSSLSSHIQNNPCAKFEVVFV
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttttctcgaatcttcgaggacccagagccggagctacccacgatgaatttccg
gcgaccaatggctctccttcgtcttcttcttctccatcttcatcaatcaagcgaaaatta
tcgaatttgttaccactctgcgttgctctggtagttatcgctgagatcgggtttctgggt
cggctcgataaagtcgctttggttgatacgttgactgatttcttcacccagtctccgtca
ctctcgcagtctccaccggcgagatccgatcggaagaagatcggattatttactgatagg
agctgcgaggagtggttgatgagagaagattcagttacttactctagagattttactaaa
gatccaatttttatctctggtggtgaaaaggactttcaatggtgttctgtggattgtaca
tttggagatagttcagggaaaacaccagatgctgcgtttggattaggtcagaaacctgga
actcttagtataatacgttccatggaatcagcacagtattatccagaaaatgatcttgca
caggcacgacggagaggttatgatatagtgatgaccactagtctatcatcagatgttcct
gttggatatttttcgtgggcggagtatgatattatgtctccggtacagccaaaaactgag
agagctattgcagctgcttttatttctaattgtggtgctcggaattttcgtctacaagca
cttgaggcattgatgaaaactaacattaagattgattcttatggtggttgtcatcgaaac
cgggatgggaaagttgacaaggttgaagctcttaagcgatacaaattcagtttggctttt
gagaatactaacgaggaagattatgtcaccgagaagttctttcaatccttagttgctggg
tccgtccccgtggtagttggtcctccaaatatagaagaatttgcgcctgcttcggactca
ttccttcacattaagactatggaagatgtagagccagttgcaaagagaatgaagtatctc
gcagctaaccctgctgcttataatcagacactaagatggaaatacgagggtccttcagat
tctttcaaggcacttgttgatatggctgctgtacactcttcttgccgtctctgcattttc
ctggccacgagggtccgagaacaagaagaggaaagccctaatttcaagaaacgaccgtgc
aaatgtagcaggggaggatcagacacagtttatcatgtttttgttagagaaagaggccgg
tttgaaatggaatcagtctttttgaggggtaaaagtgtgactcaggaagctctagaatct
gcagttctcgccaagttcaagtctttaaaacatgaggcagtgtggaagaaggaaaggcct
ggaaacttaaaaggagacaaagagcttaaaatacatcggatttacccgcttggcctaacg
caacgacaggctttgtacaacttcaaattcgagggaaattcgagtctaagtagtcacatt
caaaacaacccttgtgctaaatttgaggttgtcttcgtctag

DBGET integrated database retrieval system