KEGG   Arabidopsis thaliana (thale cress): AT1G50030Help
Entry
AT1G50030         CDS       T00041                                 

Gene name
TOR
Definition
serine/threonine-protein kinase TOR
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Protein kinases [BR:ath01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   AT1G50030 (TOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 2454 aa AA seqDB search
MSTSSQSFVAGRPASMASPSQSHRFCGPSATASGGGSFDTLNRVIADLCSRGNPKEGAPL
AFRKHVEEAVRDLSGEASSRFMEQLYDRIANLIESTDVAENMGALRAIDELTEIGFGENA
TKVSRFAGYMRTVFELKRDPEILVLASRVLGHLARAGGAMTSDEVEFQMKTAFDWLRVDR
VEYRRFAAVLILKEMAENASTVFNVHVPEFVDAIWVALRDPQLQVRERAVEALRACLRVI
EKRETRWRVQWYYRMFEATQDGLGRNAPVHSIHGSLLAVGELLRNTGEFMMSRYREVAEI
VLRYLEHRDRLVRLSITSLLPRIAHFLRDRFVTNYLTICMNHILTVLRIPAERASGFIAL
GEMAGALDGELIHYLPTIMSHLRDAIAPRKGRPLLEAVACVGNIAKAMGSTVETHVRDLL
DVMFSSSLSSTLVDALDQITISIPSLLPTVQDRLLDCISLVLSKSHYSQAKPPVTIVRGS
TVGMAPQSSDPSCSAQVQLALQTLARFNFKGHDLLEFARESVVVYLDDEDAATRKDAALC
CCRLIANSLSGITQFGSSRSTRAGGRRRRLVEEIVEKLLRTAVADADVTVRKSIFVALFG
NQCFDDYLAQADSLTAIFASLNDEDLDVREYAISVAGRLSEKNPAYVLPALRRHLIQLLT
YLELSADNKCREESAKLLGCLVRNCERLILPYVAPVQKALVARLSEGTGVNANNNIVTGV
LVTVGDLARVGGLAMRQYIPELMPLIVEALMDGAAVAKREVAVSTLGQVVQSTGYVVTPY
KEYPLLLGLLLKLLKGDLVWSTRREVLKVLGIMGALDPHVHKRNQQSLSGSHGEVPRGTG
DSGQPIPSIDELPVELRPSFATSEDYYSTVAINSLMRILRDASLLSYHKRVVRSLMIIFK
SMGLGCVPYLPKVLPELFHTVRTSDENLKDFITWGLGTLVSIVRQHIRKYLPELLSLVSE
LWSSFTLPGPIRPSRGLPVLHLLEHLCLALNDEFRTYLPVILPCFIQVLGDAERFNDYTY
VPDILHTLEVFGGTLDEHMHLLLPALIRLFKVDAPVAIRRDAIKTLTRVIPCVQVTGHIS
ALVHHLKLVLDGKNDELRKDAVDALCCLAHALGEDFTIFIESIHKLLLKHRLRHKEFEEI
HARWRRREPLIVATTATQQLSRRLPVEVIRDPVIENEIDPFEEGTDRNHQVNDGRLRTAG
EASQRSTKEDWEEWMRHFSIELLKESPSPALRTCAKLAQLQPFVGRELFAAGFVSCWAQL
NESSQKQLVRSLEMAFSSPNIPPEILATLLNLAEFMEHDEKPLPIDIRLLGALAEKCRVF
AKALHYKEMEFEGPRSKRMDANPVAVVEALIHINNQLHQHEAAVGILTYAQQHLDVQLKE
SWYEKLQRWDDALKAYTLKASQTTNPHLVLEATLGQMRCLAALARWEELNNLCKEYWSPA
EPSARLEMAPMAAQAAWNMGEWDQMAEYVSRLDDGDETKLRGLASPVSSGDGSSNGTFFR
AVLLVRRAKYDEAREYVERARKCLATELAALVLESYERAYSNMVRVQQLSELEERIQGSK
RNVEVWQALLAVRALVLPPTEDVETWLKFASLCRKSGRISQAKSTLLKLLPFDPEVSPEN
MQYHGPPQVMLGYLKYQWSLGEERKRKEAFTKLQILTRELSSVPHSQSDILASMVSSKGA
NVPLLARVNLKLGTWQWALSSGLNDGSIQEIRDAFDKSTCYAPKWAKAWHTWALFNTAVM
SHYISRGQIASQYVVSAVTGYFYSIACAANAKGVDDSLQDILRLLTLWFNHGATADVQTA
LKTGFSHVNINTWLVVLPQIIARIHSNNRAVRELIQSLLIRIGENHPQALMYPLLVACKS
ISNLRRAAAQEVVDKVRQHSGALVDQAQLVSHELIRVAILWHEMWHEALEEASRLYFGEH
NIEGMLKVLEPLHDMLDEGVKKDSTTIQERAFIEAYRHELKEAHECCCNYKITGKDAELT
QAWDLYYHVFKRIDKQLASLTTLDLESVSPELLLCRDLELAVPGTYRADAPVVTISSFSR
QLVVITSKQRPRKLTIHGNDGEDYAFLLKGHEDLRQDERVMQLFGLVNTLLENSRKTAEK
DLSIQRYSVIPLSPNSGLIGWVPNCDTLHHLIREHRDARKIILNQENKHMLSFAPDYDNL
PLIAKVEVFEYALENTEGNDLSRVLWLKSRSSEVWLERRTNYTRSLAVMSMVGYILGLGD
RHPSNLMLHRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKAMEVSGIEGNFRS
TCENVMQVLRTNKDSVMAMMEAFVHDPLINWRLFNFNEVPQLALLGNNNPNAPADVEPDE
EDEDPADIDLPQPQRSTREKEILQAVNMLGDANEVLNERAVVVMARMSHKLTGRDFSSSA
IPSNPIADHNNLLGGDSHEVEHGLSVKVQVQKLINQATSHENLCQNYVGWCPFW
NT seq 7365 nt NT seq  +upstreamnt  +downstreamnt
atgtctacctcgtcgcaatcttttgtggctggacggcctgcatccatggcttccccttcg
caatcgcaccgcttttgtggtccctcagccaccgcttctggtggcggaagctttgacact
ttgaatcgtgtcatcgctgacctttgcagccgtggtaatcctaaggagggagctccttta
gcgtttaggaaacacgtagaggaagcagttcgtgatcttagtggtgaagcttcctctagg
ttcatggagcaattatatgacaggattgctaatttaattgagagcactgatgtggcggaa
aacatgggtgcactcagagccattgatgagttgacggagattggatttggtgagaatgct
actaaggtttctagatttgcgggttacatgaggactgtgttcgagttgaagcgtgatcct
gaaatcttggtgcttgctagtagagttttggggcaccttgctcgggcaggtggagcaatg
acttctgatgaagtggagtttcagatgaaaacagcttttgattggcttcgcgtagacagg
gtggaatatcgtcgtttcgccgccgttttaatattaaaggagatggccgaaaatgcttct
actgtctttaacgttcatgtccctgaatttgtggatgctatctgggttgcacttagggac
ccccagttgcaagtgcgagaacgagctgttgaagctttgcgtgcatgccttcgtgttatt
gagaaaagggagactcgatggcgagtgcagtggtactatcgaatgtttgaagctacacag
gatgggttgggcagaaatgctccggttcacagtattcatggttctttacttgccgtgggg
gagctgttgaggaatacaggtgagttcatgatgtctaggtatagagaagttgccgaaatt
gtcctcagataccttgaacatcgtgatcgccttgttcgccttagcatcacctcgttactg
cctcgcattgctcactttctccgtgaccggtttgtgacaaactatttaacgatatgcatg
aatcatattcttactgtgttaagaataccggctgaaagagccagtgggttcatcgccctt
ggggaaatggctggtgctttggatggtgagcttatccattatttgccgacaattatgtct
catctgcgggatgcgattgctccacgtaaaggcagacctttgcttgaagctgtggcttgt
gttggtaacatcgcaaaggcaatgggatccacagtggaaactcatgttcgagatctttta
gatgttatgttttcatctagtctctcttccacacttgttgacgctcttgaccagataacc
atcagcattccttctttgctgccaacagtacaagatcggcttctagattgcatttcgttg
gttctttcaaaatcccattattctcaagcaaagcctcctgttaccattgtccgaggtagt
acagtgggcatggcaccacagtcttctgaccctagttgttcagctcaagttcaactagcc
ctgcagactcttgctcgtttcaatttcaagggacatgatcttcttgaatttgctcgggag
tcagttgttgtttatttggatgatgaggatgcagccacaagaaaagatgctgctttgtgt
tgttgcagactaattgcaaattctctttctggcatcacacaatttggctcgagcaggtca
acacgagcaggggggagacgcaggcgccttgtggaagagattgtggaaaagcttctcagg
acagccgttgcagatgctgatgtaactgttcgcaaatctatattcgttgctttatttggc
aaccaatgtttcgatgattatctagcacaggctgatagtttgactgccatttttgcttcc
ttaaatgatgaggaccttgatgttcgagaatatgccatctcagttgctggaaggttatcg
gaaaaaaatccagcatacgtacttccagcacttcgtcgccatcttatacagttgttgacc
tatcttgagctgagtgcagataacaagtgcagggaagagagtgcaaagctccttggttgt
ttagttcgaaattgtgaacggctcattcttccatacgtagcccctgtccaaaaggcactt
gttgcgagacttagtgaaggaactggagtgaatgctaacaataatattgtcactggagtt
ctcgtaactgttggggatcttgcaagagtgggtggcttggcaatgagacaatatattccg
gagctgatgcctttaattgttgaagctttaatggatggagctgctgtagcaaaacgtgag
gtggctgtttctactcttggtcaagttgttcaaagtacagggtatgttgtgactccatac
aaggaatacccattgttgcttgggttactcttgaaattgctgaagggtgacttagtgtgg
tctaccagacgagaagtgctcaaggttcttggaattatgggcgctttggatcctcatgtg
cataaacgtaaccaacaaagtttatcaggatcacatggtgaagttcctcgcggcactggt
gattctggtcaacctattccatcaattgatgagttacctgtcgaactccggccgtcattt
gctacatctgaggattattactcaacggttgctatcaactcgcttatgcgaattcttaga
gatgcatcacttcttagttaccacaaaagggttgttagatctctgatgatcattttcaag
tcaatgggattgggatgcgtgccttacttgccgaaggttttacctgagctttttcacact
gttcgaacatctgatgagaacctgaaggacttcattacgtggggtcttgggactcttgtt
tccattgttcgccagcacatacgcaagtatctgccagagctgctttcattagtctctgaa
ctatggtcatccttcaccttgcccggtcccatacgcccatcacgtggtcttccggttctg
catctactggaacatctttgcttggcacttaatgatgaattcagaacttatcttccagtc
atccttccatgtttcatccaagtattaggtgacgccgagcggtttaatgattacacctat
gttcctgatattctccacacactcgaagtgtttggcggaactcttgatgagcacatgcat
ttactccttccggcacttattcgattgtttaaagtagatgctcctgtagctataagacgc
gatgccatcaaaactttgacaagagtaatcccgtgtgttcaggttactggtcatatctcc
gctctcgtgcatcacttgaagctagtattagatgggaagaatgatgagttgcggaaagat
gctgtcgatgcactatgctgtttggctcatgcacttggagaggacttcaccatattcatt
gaatcaattcacaagcttttattgaagcatcgattgcggcataaagaatttgaggaaatt
catgctcgctggcggagacgtgaaccattgattgtagctacaactgcaacccaacaatta
agtaggcgactgccagttgaggttatcagggatcctgtaattgagaatgagatcgatcct
ttcgaagaaggaactgacagaaaccatcaggttaatgatggtagactacggacagctgga
gaagcttctcaacgcagcaccaaagaagattgggaggaatggatgagacattttagtatt
gaattacttaaggagtctccctctccagcattaagaacttgtgcaaaacttgctcagttg
cagccatttgtcgggagagagttgtttgctgctggctttgtcagttgctgggcacagcta
aacgagtctagccaaaagcagttagttaggagcttggaaatggccttttcatctccaaat
atccctccagaaattttagctacactactcaatttggcagagtttatggaacatgatgag
aagcctcttcccattgatattcgtcttctgggggctcttgctgaaaagtgccgtgttttt
gccaaagctctgcattataaagagatggaatttgaaggtccacgatccaagaggatggat
gccaacccagttgctgttgtcgaggctcttatacacataaataatcagttacaccagcat
gaggctgctgtcggtatactaacctatgctcaacaacatcttgatgtgcaattaaaagaa
tcatggtatgagaagctgcagcgctgggacgatgcactcaaggcgtacactttgaaagca
tctcaaacaacaaatcctcatcttgtattagaagccacattaggacaaatgagatgtctt
gctgcacttgcacgatgggaagagctcaacaatctctgcaaagagtactggagtcctgct
gagccatctgcgcgtctggaaatggcaccaatggctgcacaagctgcatggaacatggga
gagtgggatcaaatggccgaatatgtgtctcggctagatgatggtgatgaaacaaagctt
cggggtttagcaagcccggtttctagtggcgatgggagcagtaatggcacattcttcagg
gctgttctgttagttcgaagggcaaagtacgacgaggcacgcgaatatgtggaaagagct
agaaaatgtcttgccacagaacttgcagcgctggttttggagagctatgagcgtgcgtac
agcaatatggttcgtgttcagcagctgtcagaactagaggagcggattcagggatctaag
cgtaatgtggaggtgtggcaagcacttttggctgtccgggcacttgtgctacctcctaca
gaagatgtggaaacttggctcaagtttgcctcgctttgtcgaaagagtgggaggatcagt
caggcgaaatctactctactcaagctcttaccgtttgatccagaagtatcaccagaaaac
atgcaatatcacggacctccacaagtgatgcttggatacttaaaataccaatggtcactt
ggagaggaacgtaagcgcaaagaggcatttaccaagctgcagattctaacgagagagctc
tcaagtgtgccacattctcaatctgacatactggctagcatggtatctagcaagggcgca
aatgttccacttcttgcacgtgtaaatctcaaactgggaacgtggcagtgggcactttct
tccggtttgaatgatgggtctattcaagaaattcgtgatgcgtttgacaaatctacttgc
tatgctcctaaatgggctaaagcatggcacacatgggcattattcaatacagcagtgatg
tcgcattacatttcaagaggtcaaattgcttcccagtacgttgtttctgcagtcactgga
tatttttattctatagcatgtgcagcaaatgccaaaggagttgatgatagtttacaggac
atactgcgtcttctgacattgtggttcaaccatggagctacagctgatgtccaaaccgca
ttgaagacaggattcagtcatgtcaacattaacacatggcttgttgtgctacctcaaatc
attgctaggatacattctaataatcgtgctgtcagggaactgattcagtctcttctcatc
cgcataggcgaaaaccacccacaggctctgatgtatccccttctcgttgcatgtaaatca
ataagcaatcttcggagagctgcggctcaagaggtggttgataaagttcgccagcacagt
ggtgcactcgtggatcaggcgcaacttgtatcacatgaacttatcagggttgccatactt
tggcatgaaatgtggcatgaagcactagaagaagctagtcgcttgtattttggtgaacat
aacattgaaggcatgctgaaagtacttgaacccttacatgacatgctcgacgaaggtgta
aaaaaggacagtacgaccatacaggaaagagcatttatagaggcataccgtcacgaacta
aaagaggcacatgaatgctgttgcaattacaagataactgggaaagatgctgaacttaca
caggcttgggatctttactatcacgttttcaaacggattgacaaacagctagccagtctc
acgacattggatttggaatctgtttctcctgagttgctgctgtgccgtgacttggagcta
gcagttcctggaacatatcgtgcagatgcccccgtcgtgactatatcatctttttcacgc
caacttgttgttataacctctaaacaaagaccaaggaaattgactattcacggaaatgac
ggtgaggactacgccttcttgttgaagggacatgaagatttaaggcaagatgagcgtgtt
atgcagctttttggtttggtgaacactttgcttgagaattccagaaaaacagccgaaaaa
gatctttccattcaacgctattctgtaataccactatctcccaatagtggactcatcgga
tgggttccgaactgcgatacccttcaccatcttattcgagagcacagagatgcaagaaag
atcattcttaatcaagaaaataagcatatgttgagttttgctccagactatgacaatcta
ccgcttatagcaaaggttgaagtatttgagtatgctctagaaaacacagagggaaatgat
ctatccagggttctctggttaaaaagtcgctcgtcagaagtttggctagaaagaagaaca
aactatactagaagtttagcagttatgagtatggttggttatattcttgggttaggtgat
cgacacccaagtaaccttatgcttcatagatacagtggaaagatcttgcatattgatttt
ggagattgttttgaggcttctatgaatagagagaagtttcctgaaaaggttccattccgc
ctgacaagaatgcttgtcaaagcaatggaagtcagtggcattgaaggaaacttccgctca
acctgcgaaaacgttatgcaagttctcagaaccaataaagatagtgtaatggcaatgatg
gaagcgtttgtacatgatcctttaatcaattggcgtcttttcaatttcaatgaagtcccc
caattagcactgctcggtaacaacaaccccaatgctcctgctgatgttgagcctgacgaa
gaagatgaagatcccgctgatatagatcttcctcagcctcaaaggagtactcgagagaag
gagattcttcaggctgtaaatatgcttggagatgctaatgaagttttaaatgagcgtgcc
gtagttgttatggcacgtatgagtcataagcttacagggcgtgatttttcttcgtctgca
attccgagcaatcccattgctgatcataataacttgctcggaggagattctcatgaagtc
gaacatggtttgtctgtgaaagttcaggttcaaaaactaatcaatcaagccacttcccat
gagaatctctgtcaaaactatgttgggtggtgccctttctggtga

DBGET integrated database retrieval system