KEGG   Arabidopsis thaliana (thale cress): AT1G50640Help
Entry
AT1G50640         CDS       T00041                                 

Gene name
ERF3
Definition
ethylene-responsive transcription factor 3
Orthology
K09286  
EREBP-like factor
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Other transcription factors
   EREBP
    AT1G50640 (ERF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 225 aa AA seqDB search
MRRGRGSSAVAGPTVVAAINGSVKEIRFRGVRKRPWGRFAAEIRDPWKKARVWLGTFDSA
EEAARAYDSAARNLRGPKAKTNFPIDSSSPPPPNLRFNQIRNQNQNQVDPFMDHRLFTDH
QQQFPIVNRPTSSSMSSTVESFSGPRPTTMKPATTKRYPRTPPVVPEDCHSDCDSSSSVI
DDDDDIASSSRRRNPPFQFDLNFPPLDCVDLFNGADDLHCTDLRL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaggagaggaagaggctcttccgccgtcgccggacctaccgtcgttgccgccatcaac
ggatctgtaaaagaaatcagattcagaggcgtaaggaagagaccttggggacgattcgca
gctgagatccgtgatccatggaaaaaagctcgtgtttggttaggtactttcgattccgcc
gaagaagctgctcgcgcttacgactccgccgctcgtaacctccgtggtcctaaagccaaa
actaatttccccatcgattcttcttctcctcctcctcctaatctccgatttaatcagatt
cgtaatcaaaatcaaaaccaagtcgatccgtttatggaccaccggttattcaccgaccat
caacaacagttcccgattgttaaccggcctactagtagcagcatgagcagcaccgttgaa
tcgtttagcggacccagacctacgacgatgaaaccggccacgacgaagagatatcctaga
actccaccggttgttccggaggattgtcacagcgattgcgattcgtcgtcgtctgtaatc
gacgacgacgacgatatcgcatcgtcttcacggcgacggaatccgccgtttcaattcgat
cttaattttccaccgttggattgtgttgacttgttcaatggcgctgatgatcttcactgt
accgatctacgtctctaa

DBGET integrated database retrieval system