KEGG   Arabidopsis thaliana (thale cress): AT1G51470Help
Entry
AT1G51470         CDS       T00041                                 

Gene name
BGLU35
Definition
(RefSeq) myrosinase 5
  KO
K01237  
myrosinase [EC:3.2.1.147]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    AT1G51470 (BGLU35)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.147  thioglucosidase
     AT1G51470 (BGLU35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 511 aa AA seqDB search
MAIPKAHYSLAVLVLLFVVVSSSQKVCNPECKAKEPFHCDNTHAFNRSGFPKNFTFGAAT
SAYQIEGAAHRALNGWDYFTHRYPEKVPDRSSADLACDSYDLYKDDVKLLKRMNVQAYRL
SIAWSRVLPKGRLTGGVDENGITYYNNLINELKANGIEPYVTIFHWDVPQTLEDEYGGFL
STRIVEDYTNYAELLFQRFGDRVKFWITLNQPLSLALKGYGNGSYPPGRCTGCELGGDSG
VEPYTVAHNQLLAHAKTVSLYRKRYQKFQGGKIGTTLIGRWFVPLNEFSELDKAAAKRAF
DFFVGWFLDPLVYGKYPTIMREMVGDRLPEFTPEESALVKGSLDFLGLNYYVSQYATDAP
PPTQPNAITDARVTLGFYRNGSPIGVVASSFVYYPPGFRQILNYIKDNYKNPLTYITENG
VADLDLGNVTLATALADNGRIQNHCSHLSCLKCAMKDGCNVAGYFAWSLMDNYEFGNGYT
LRFGMNWVNFTNPADRKEKASGKWFSKFLAK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggcaattccaaaagctcactactctttagcagttcttgtccttctctttgtcgtcgtt
tcgagtagccaaaaagtctgcaatccagaatgcaaggccaaagaacccttccactgcgat
aatactcatgcattcaaccgtagtggatttcccaaaaatttcacttttggtgcagctact
tcggcttatcaaattgaaggtgcagcacatagagcacttaatggatgggactatttcacg
catagatatccagaaaaagtaccggatcgtagttcagcagatcttgcttgtgattcgtat
gatctttataaggatgatgtcaaactgctaaaaagaatgaatgttcaagcataccgtctc
tcgatagcatggtcaagggtcttaccaaagggaagactgactgggggagtggacgagaat
gggataacatactacaacaatctcattaacgagttgaaagcaaatggcatagaaccatat
gttactatatttcattgggatgttccccagactttagaagacgaatatggaggcttctta
agcacacgtatagtggaggactacacaaactacgctgagcttctattccaaagattcgga
gacagggtcaaattttggatcactttaaatcagcctctctctcttgcactcaaaggctat
ggaaatggatcttatccaccaggacggtgcaccggctgtgaacttggaggagattctgga
gttgaaccttatacagttgcacataaccaacttctagctcatgcaaaaactgtctcttta
tacagaaaaagatatcagaaatttcaaggtggtaagataggaacaaccttgatcgggaga
tggttcgtcccgctaaatgaatttagtgaactcgacaaggctgctgcaaaacgagcattc
gacttttttgttggatggttcttggatccattggtgtacggaaaatatccaacaataatg
agagagatggtaggagatagattgccagaattcacacctgaggaatcagctttagttaaa
ggatcacttgattttctagggttgaactattacgtttcacaatatgcaactgacgcacct
cctccgacacaacctaatgcaataacggatgcacgagttactcttggattttaccgcaat
ggaagtcctattggtgttgtggcttctagcttcgtctactatcctccaggattccgtcag
attctaaactacatcaaagacaactacaaaaatccacttacctacatcaccgaaaacgga
gttgctgatcttgatcttggaaacgtaacgcttgcaactgctcttgccgataatggacgg
attcaaaaccattgcagccatctctcttgtctcaaatgcgccatgaaggatggatgcaac
gtagcaggatattttgcatggtcattgatggacaattacgaattcggaaatggttacacc
ctccggtttggtatgaattgggtcaacttcactaatcctgctgatcgtaaagagaaagct
tctggaaaatggttctctaagttcctcgcaaaataa

DBGET integrated database retrieval system