KEGG   Arabidopsis thaliana (thale cress): AT1G51660Help
Entry
AT1G51660         CDS       T00041                                 

Gene name
MKK4
Definition
mitogen-activated protein kinase kinase 4
Orthology
K13413  
mitogen-activated protein kinase kinase 4/5, plant [EC:2.7.12.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    AT1G51660 (MKK4)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     AT1G51660 (MKK4)
Protein kinases [BR:ath01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   AT1G51660 (MKK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 366 aa AA seqDB search
MRPIQSPPGVSVPVKSRPRRRPDLTLPLPQRDVSLAVPLPLPPTSGGSGGSSGSAPSSGG
SASSTNTNSSIEAKNYSDLVRGNRIGSGAGGTVYKVIHRPSSRLYALKVIYGNHEETVRR
QICREIEILRDVNHPNVVKCHEMFDQNGEIQVLLEFMDKGSLEGAHVWKEQQLADLSRQI
LSGLAYLHSRHIVHRDIKPSNLLINSAKNVKIADFGVSRILAQTMDPCNSSVGTIAYMSP
ERINTDLNQGKYDGYAGDIWSLGVSILEFYLGRFPFPVSRQGDWASLMCAICMSQPPEAP
ATASPEFRHFISCCLQREPGKRRSAMQLLQHPFILRASPSQNRSPQNLHQLLPPPRPLSS
SSSPTT
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagaccgattcaatcgcctccaggagtttccgttccggtgaaaagccgtccccgtcgc
cgtcctgatcttaccttaccgcttcctcaacgcgatgtttctctcgctgtacctcttcct
ctcccacctacttccggtggttccggtggctctagtggatctgcgccgtcttctggtggt
tcggcgtcttcaacgaacactaacagctccatagaagcgaagaactattcggatttagtg
agaggtaaccgtatcggaagcggagcaggtggaacggtatacaaagtgattcaccgtccg
agttctcgtctatatgcacttaaggtgatatacggtaaccacgaggagactgtgagacgt
cagatctgtagagagatcgagattttacgagatgtgaatcatccaaacgttgtgaaatgt
cacgagatgtttgatcagaacggtgagatccaggttttgcttgagtttatggataaaggt
tctttagaaggtgctcatgtgtggaaagagcaacaattagctgatctatctcgtcagatt
cttagtggtttagcttatctccatagccgtcacatagttcatcgtgatatcaaaccatcg
aatcttttgataaactctgctaaaaacgttaagattgctgattttggagttagtaggatc
ttggctcagactatggatccgtgtaattcatctgttggaaccattgcttatatgagtcct
gagaggattaacactgatttgaatcagggaaagtatgatggttatgctggagatatttgg
agcttaggtgttagcattttggagttttacttggggaggtttcctttccctgtgagtaga
caaggtgattgggctagtcttatgtgtgccatttgtatgtctcagcctccagaagctcca
gcgactgcgtcgccggagtttcggcattttatctcgtgttgcttgcagagagaaccgggg
aaaaggaggagtgctatgcagctattgcagcatcctttcatattaagagcaagtccgagc
cagaacaggtctcctcagaatctacatcaactcttgcctcctcctcgtcctctgtcctcg
tcttcttctccaaccacatag

DBGET integrated database retrieval system