KEGG   Arabidopsis thaliana (thale cress): AT1G51710Help
Entry
AT1G51710         CDS       T00041                                 

Gene name
UBP6
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 6
  KO
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AT1G51710 (UBP6)
Peptidases [BR:ath01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AT1G51710 (UBP6)
Ubiquitin system [BR:ath04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    AT1G51710 (UBP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 482 aa AA seqDB search
MPTVSVKWQKKVLDGIEIDVSLPPYVFKAQLYDLTGVPPERQKIMVKGGLLKDDGDWAAI
GVKDGQKLMMMGTADEIVKAPEKAIVFAEDLPEEALATNLGYSAGLVNLGNTCYMNSTVQ
CLKSVPELKSALSNYSLAARSNDVDQTSHMLTVATRELFGELDRSVNAVSPSQFWMVLRK
KYPQFSQLQNGMHMQQDAEECWTQLLYTLSQSLKAPTSSEGADAVKALFGVNLQSRLHCQ
ESGEESSETESVYSLKCHISHEVNHLHEGLKHGLKGELEKTSPALGRTALYVKESLIDSL
PRYLTVQFVRFFWKRESNQKAKILRKVDYPLVLDIFDLCSEDLRKKLEAPRQKLREEEGK
KLGLQTSAKSGSKDSDVKMTDAEASANGSGESSTVNPQEGTSSEKETHMTGIYDLVAVLT
HKGRSADSGHYVAWVKQESGKWIQYDDDNPSMQREEDITKLSGGGDWHMAYITMYKARFV
SM
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcctacagtaagcgtgaagtggcaaaagaaagtgttggatggtatcgagattgacgtt
agtctgcctccttatgttttcaaggctcagttgtatgatttgactggagttccaccagaa
cgccaaaagatcatggtcaaaggtggtctcttaaaggatgatggagattgggctgctatt
ggtgtgaaagatggtcaaaaattgatgatgatgggaactgctgatgagatagtgaaagct
cctgagaaggccattgtttttgcagaggatctacctgaagaagcgctagccactaatctg
ggttacagtgctggccttgtcaatcttggcaacacgtgttacatgaactccacggtgcag
tgcttaaaatctgtcccagagttgaaatctgcattatccaattactcacttgctgcccga
agcaatgatgttgaccagacttctcacatgctcacagttgccacacgtgagttatttggt
gagcttgatagaagtgtcaatgctgtttcgccttcacagttctggatggtattacgaaaa
aagtatcctcagtttagtcagttgcagaatggaatgcacatgcagcaggatgctgaagaa
tgttggacacaactgttatacaccctttctcagtccctaaaagcaccaacttccagcgaa
ggtgctgatgctgtgaaagctctatttggtgtcaatctccagagcaggttgcattgtcaa
gaaagtggcgaagaaagctcagagacagaatctgtatattctctaaaatgtcatatatca
catgaagtgaaccacttgcatgaaggattaaaacatggactgaaaggggaacttgaaaaa
acatctcctgctcttggccgtactgcactctacgtcaaggagtcacttatagattccttg
ccaaggtacttgactgttcagttcgtgcggtttttctggaaaagggagagtaatcagaaa
gcaaagatcctcaggaaagtggattacccgctggtgttggatatatttgacctttgctct
gaggatcttcggaagaaactggaagctcctcgccagaaacttagagaggaggaaggtaaa
aagcttggtcttcaaactagtgctaagagtggctcaaaggacagtgatgtgaaaatgact
gatgcagaggcgtctgcaaatggaagtggagaatcatccacagtaaacccacaggaaggt
acttcttctgagaaggaaactcacatgactggaatctatgacttggtcgctgtgttgacc
cacaagggcaggagtgcagactctggtcattatgttgcatgggtcaagcaagagagtggc
aaatggattcaatatgatgatgacaacccgagcatgcaacgcgaagaagacatcacaaag
ctatctggaggaggtgattggcatatggcgtacatcacaatgtacaaagcccgcttcgtc
tccatgtaa

DBGET integrated database retrieval system