KEGG   Arabidopsis thaliana (thale cress): AT1G52760Help
Entry
AT1G52760         CDS       T00041                                 

Gene name
LysoPL2
Definition
(RefSeq) lysophospholipase 2
  KO
K18368  
caffeoylshikimate esterase [EC:3.1.1.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Phenylpropanoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Monolignol biosynthesis, phenylalanine/tyrosine  => monolignol
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT1G52760 (LysoPL2)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     AT1G52760 (LysoPL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 332 aa AA seqDB search
MPSEAESSANSAPATPPPPPNFWGTMPEEEYYTSQGVRNSKSYFETPNGKLFTQSFLPLD
GEIKGTVYMSHGYGSDTSWMFQKICMSFSSWGYAVFAADLLGHGRSDGIRCYMGDMEKVA
ATSLAFFKHVRCSDPYKDLPAFLFGESMGGLVTLLMYFQSEPETWTGLMFSAPLFVIPED
MKPSKAHLFAYGLLFGLADTWAAMPDNKMVGKAIKDPEKLKIIASNPQRYTGKPRVGTMR
ELLRKTQYVQENFGKVTIPVFTAHGTADGVTCPTSSKLLYEKASSADKTLKIYEGMYHSL
IQGEPDENAEIVLKDMREWIDEKVKKYGSKTA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcggaagcggagagctcagcgaattcagctccggcaactccgccaccaccaccg
aatttctggggaaccatgccggaggaagagtactacacttcacaaggagtacgtaacagc
aaatcatacttcgaaacaccaaacggcaagctcttcactcagagcttcttaccattagat
ggtgaaatcaaaggcactgtgtacatgtctcatggatacggatccgatacaagctggatg
tttcagaagatctgtatgagtttctctagttggggttacgctgttttcgccgccgatctt
ctcggtcacggccgttccgatggtatccgctgctacatgggtgatatggagaaagttgca
gcaacatcattggctttcttcaagcatgttcgttgtagtgatccatataaggatcttccg
gcttttctgtttggtgaatcgatgggaggtcttgtgacgcttttgatgtattttcaatcg
gaacctgagacttggaccggtttgatgttttcggctcctctctttgttatccctgaggat
atgaaaccaagcaaggctcatctttttgcttatggtctcctctttggtttggctgatacg
tgggctgcaatgccggataataagatggttgggaaggctatcaaggaccctgaaaagctt
aagatcatcgcttctaacccgcaaagatatacagggaagcctagagtgggaacaatgaga
gagttactgaggaagactcaatacgttcaggagaatttcgggaaagttactattccggtg
tttacggcgcacgggacagcggatggagtaacatgtcctacatcttcgaagctactatac
gaaaaagcgtcaagcgctgataaaacgttgaagatctatgaagggatgtatcactcgctg
attcaaggagagcctgacgagaacgctgagatagtcttgaaggatatgagagagtggatc
gatgagaaggttaagaagtatggatctaaaaccgcttga

DBGET integrated database retrieval system