KEGG   Arabidopsis thaliana (thale cress): AT1G56280Help
Entry
AT1G56280         CDS       T00041                                 

Gene name
DI19
Definition
(RefSeq) drought-induced protein 19
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 200 aa AA seqDB search
MDADSKRFLATLRSRSEMLMGFEEIDGDDDFQEEFACPFCAESYDIIGLCCHIDDEHTLE
SKNAVCPVCSLKVGVDIVAHKRFTMGRKRKSRKSGTNSTLSLLRKELREGDLQRLLGFTS
RNGSVASSVTPDPLLSSFISPTRSQSSPAPRQTKNVSEDKQIERKRQVFISPVSLKDREE
RRHKSEFVQRLLSSAIFDEV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgattccaagagatttctagctacgcttcgatcccgatctgaaatgttaatg
ggctttgaagaaatagatggagatgatgatttccaggaggagtttgcttgcccgttctgt
gcagaatcgtatgatatcatcgggttgtgctgtcacatagatgatgaacatactttagag
tcgaagaacgcggtatgccctgtttgttctcttaaagtgggagttgatatcgtagcacac
aaacgcttcaccatgggacgaaagagaaagtcacgaaaaagcggtaccaattcgacactt
tcacttcttcggaaagaactaagagaaggagatctacaaaggttgttaggatttacttct
cgtaatggttctgttgcgtcaagtgtaactcctgatcctctcctgtcgtcatttatctca
cctacacgatcacagagttctcctgcgccacgccaaaccaaaaacgtatccgaggataaa
cagatagagcgcaagagacaagtgttcatctcaccggtctcgttaaaagatcgggaagag
aggaggcacaaatcagagtttgttcagaggctcttgtcatcagccattttcgatgaagtc
taa

DBGET integrated database retrieval system