KEGG   Arabidopsis thaliana (thale cress): AT1G56570Help
Entry
AT1G56570         CDS       T00041                                 

Gene name
PGN
Definition
(RefSeq) Tetratricopeptide repeat (TPR)-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR_2 PPR PPR_1 PPR_3 PPR_long DYW_deaminase DUF3927 ATP13
Motif
Other DBs
NCBI-GeneID: 842111
NCBI-ProteinID: NP_001319256
MIPS: AT1G56570.1
TAIR: AT1G56570
Araport: AT1G56570
UniProt: Q9FXA9
Position
1
AA seq 611 aa AA seqDB search
MSITKLARSNAFKPIPNFVRSSLRNAGVESSQNTEYPPYKPKKHHILATNLIVSYFEKGL
VEEARSLFDEMPDRDVVAWTAMITGYASSNYNARAWECFHEMVKQGTSPNEFTLSSVLKS
CRNMKVLAYGALVHGVVVKLGMEGSLYVDNAMMNMYATCSVTMEAACLIFRDIKVKNDVT
WTTLITGFTHLGDGIGGLKMYKQMLLENAEVTPYCITIAVRASASIDSVTTGKQIHASVI
KRGFQSNLPVMNSILDLYCRCGYLSEAKHYFHEMEDKDLITWNTLISELERSDSSEALLM
FQRFESQGFVPNCYTFTSLVAACANIAALNCGQQLHGRIFRRGFNKNVELANALIDMYAK
CGNIPDSQRVFGEIVDRRNLVSWTSMMIGYGSHGYGAEAVELFDKMVSSGIRPDRIVFMA
VLSACRHAGLVEKGLKYFNVMESEYGINPDRDIYNCVVDLLGRAGKIGEAYELVERMPFK
PDESTWGAILGACKAHKHNGLISRLAARKVMELKPKMVGTYVMLSYIYAAEGKWVDFARV
RKMMRMMGNKKEAGMSWILVENQVFSFAVSDKMCPNASSVYSVLGLLIEETREAGYVPEL
DSLVNDQEVGT
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgagcataaccaaacttgcacgctccaatgcgtttaaaccaatcccaaactttgtcaga
agctctctacgcaacgccggcgtcgaatcaagtcaaaacacagagtatcctccatataaa
cccaagaagcatcacattttagcaacaaatctaatcgtttcatatttcgaaaaaggttta
gtcgaagaagcacgctcactgttcgacgaaatgcctgatagagacgtagtagcttggacc
gcaatgatcactggttacgcttcttccaactacaatgctcgtgcttgggagtgttttcac
gagatggttaagcaaggaacaagcccgaatgagttcacgctctcgagtgttctcaagtct
tgtagaaacatgaaggttttggcttatggtgctttggttcatggagttgtggttaaactt
ggcatggaaggttctctttatgttgacaatgcgatgatgaatatgtacgccacttgttct
gtaacaatggaggctgcttgtttgatttttcgggatattaaggtgaaaaatgatgttact
tggactactctaatcaccgggtttacgcatttgggtgatggcattggcggtttaaagatg
tacaagcaaatgttgctggagaatgctgaagtgacgccttactgtataacaatagcggtt
agagcttccgcttcgattgattcagttacaaccggcaagcaaattcatgcgtctgtgatt
aaacgtgggtttcagtctaacctcccggtgatgaactctatattggacttgtattgcagg
tgtggttatttatcagaagcgaaacactatttccatgagatggaagataaagatttaatc
acatggaacactttaatatccgagcttgagcgatcagatagtagtgaagctctgcttatg
tttcagcggtttgaatcgcaaggctttgtgccaaattgttacactttcacgagtttagtt
gctgcttgtgccaatatagcggcattgaactgtggtcagcaacttcatggaaggattttt
agaagagggtttaacaagaacgttgagttagctaatgctttgatcgatatgtatgctaaa
tgcggaaatataccggactctcaaagagtatttggtgaaattgtagataggaggaatttg
gtgtcttggacttcaatgatgattgggtatggatcacatggttatggagcagaagctgtt
gagctttttgataaaatggttagttcgggtattagacctgaccggattgtgttcatggcg
gttttaagtgcgtgtcgccatgctggtttagtggagaaaggattgaagtactttaatgtg
atggaaagtgagtatggtataaatccagatcgagatatctacaactgtgtggtggatttg
cttggaagagctgggaaaataggtgaggcttatgaattagttgagagaatgccgtttaag
ccagacgaatccacgtggggagcgattcttggggcttgtaaagcgcataagcacaatgga
ttgataagtagattagctgcaagaaaagttatggagttgaaaccaaaaatggtggggact
tatgtgatgctttcatacatctatgcagcagaagggaagtgggtcgatttcgcgagagtg
aggaagatgatgaggatgatggggaacaaaaaagaagccggtatgagctggatcctggtg
gaaaatcaagtttttagctttgccgttagcgataaaatgtgtcctaatgcgagttccgtg
tattcagtcttggggttactgatagaagagactagagaagctggatatgttcctgaatta
gactccttagttaatgatcaagaagtcggaacttga

DBGET integrated database retrieval system