KEGG   Arabidopsis thaliana (thale cress): AT1G59720Help
Entry
AT1G59720         CDS       T00041                                 

Gene name
CRR28
Definition
(RefSeq) Tetratricopeptide repeat (TPR)-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR_2 PPR DYW_deaminase PPR_1 PPR_3
Motif
Other DBs
NCBI-GeneID: 842263
NCBI-ProteinID: NP_176180
MIPS: AT1G59720.1
TAIR: AT1G59720
Araport: AT1G59720
UniProt: Q0WQW5
Position
1
AA seq 638 aa AA seqDB search
MVVRSIIVSPPTTITYYHPMSIGLLVHPLSPHIPPASSPSASTAGNHHQRIFSLAETCSD
MSQLKQLHAFTLRTTYPEEPATLFLYGKILQLSSSFSDVNYAFRVFDSIENHSSFMWNTL
IRACAHDVSRKEEAFMLYRKMLERGESSPDKHTFPFVLKACAYIFGFSEGKQVHCQIVKH
GFGGDVYVNNGLIHLYGSCGCLDLARKVFDEMPERSLVSWNSMIDALVRFGEYDSALQLF
REMQRSFEPDGYTMQSVLSACAGLGSLSLGTWAHAFLLRKCDVDVAMDVLVKNSLIEMYC
KCGSLRMAEQVFQGMQKRDLASWNAMILGFATHGRAEEAMNFFDRMVDKRENVRPNSVTF
VGLLIACNHRGFVNKGRQYFDMMVRDYCIEPALEHYGCIVDLIARAGYITEAIDMVMSMP
MKPDAVIWRSLLDACCKKGASVELSEEIARNIIGTKEDNESSNGNCSGAYVLLSRVYASA
SRWNDVGIVRKLMSEHGIRKEPGCSSIEINGISHEFFAGDTSHPQTKQIYQQLKVIDDRL
RSIGYLPDRSQAPLVDATNDGSKEYSLRLHSERLAIAFGLINLPPQTPIRIFKNLRVCND
CHEVTKLISKVFNTEIIVRDRVRFHHFKDGSCSCLDYW
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggttgttcgttcaattatcgtttcacctccaacaactataacttattaccatccaatg
tctatcggtcttctggtccacccattatctcctcatatcccaccggcaagttctccctca
gcctccaccgccggtaaccatcaccaacgtattttctccttagcagaaacatgttcagac
atgtctcagctcaagcaacttcacgccttcactctccgtactacttaccctgaggaaccc
gcaactctgtttctctacggcaaaatcctccagctctcttcctccttctccgacgtcaat
tacgcgttccgggttttcgactccatcgaaaaccatagctctttcatgtggaacactctt
ataagagcatgtgctcatgatgtttcaaggaaagaagaagcctttatgctttaccggaaa
atgttagagagaggtgaatcttcaccggataagcatacgtttccgtttgtattgaaagct
tgcgcttatatattcgggttctccgaagggaagcaagttcattgtcagattgtgaaacat
gggtttggtggagatgtgtatgttaataatggtttgattcatttgtatgggtcttgtggg
tgtttggatttagcacggaaagtgtttgatgaaatgcctgagagaagtcttgtttcgtgg
aattcgatgatcgatgctctggttcggtttggggagtatgattctgcgttacaactgttt
agagagatgcagagatcgtttgaaccagatggttatacgatgcagagtgttttgagtgcg
tgtgctggtcttggatctttgtcactaggtacttgggcacatgcgtttctgctgcgaaaa
tgtgatgtcgatgttgctatggatgttttggttaagaactcgttgatcgaaatgtattgc
aaatgcgggtcgttgagaatggctgagcaagtgtttcaggggatgcaaaaacgtgactta
gcttcatggaatgcaatgattctagggtttgctacacatggaagagctgaggaagccatg
aatttcttcgaccgtatggtggataaaagagagaatgttagaccgaactcagtcacgttt
gttggcttgctcatcgcctgcaaccaccgaggctttgtaaacaaagggcgccagtatttt
gacatgatggtcagagattattgcatcgaacctgcgttggagcattacggttgcatcgtc
gaccttattgctcgtgcaggctacattactgaagctattgacatggtaatgagcatgcca
atgaaaccagatgcagtgatatggagaagtctccttgatgcttgttgcaaaaagggtgct
agtgtggagctaagtgaagaaattgctagaaatattattggaacaaaggaagataacgaa
agctccaatggtaactgcagtggtgcatatgtactgttgtctagagtttatgcatcagct
agccgctggaacgatgttggaatcgttagaaaactaatgagtgaacatggaattagaaaa
gagcctggatgcagttctattgagataaatggcatctcccacgagtttttcgcaggagac
acgtcgcatcctcagaccaaacagatataccaacagttgaaggtgatcgacgacaggcta
agatcaattggttatttaccggatcgctctcaagcacctttagtggatgccaccaatgat
ggtagcaaagagtattcccttaggctgcacagtgaaagacttgccattgcttttggtctg
ataaacttaccacctcagactccaatccgtatattcaagaatctacgtgtctgcaacgat
tgccacgaggttactaaactgatctcaaaagtcttcaacactgagatcatcgtgagagat
cgtgttcgtttccatcacttcaaagatggatcctgctcttgtttagactactggtag

DBGET integrated database retrieval system