KEGG   Arabidopsis thaliana (thale cress): AT1G59940Help
Entry
AT1G59940         CDS       T00041                                 

Gene name
ARR3
Definition
(RefSeq) response regulator 3
  KO
K14492  two-component response regulator ARR-A family
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    AT1G59940 (ARR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Response_reg
Motif
Other DBs
NCBI-GeneID: 842288
NCBI-ProteinID: NP_176202
MIPS: AT1G59940.1
TAIR: AT1G59940
Araport: AT1G59940
UniProt: Q9ZWS9 Q29PQ8
Position
1
AA seq 231 aa AA seqDB search
MAKDGGVSCLRRSEMIGIGIGELESPPLDSDQVHVLAVDDSLVDRIVIERLLRITSCKVT
AVDSGWRALEFLGLDDDKAAVEFDRLKVDLIITDYCMPGMTGYELLKKIKESTSFKEVPV
VIMSSENVMTRIDRCLEEGAEDFLLKPVKLADVKRLRSYLTRDVKVAAEGNKRKLTTPPP
PPPLSATSSMESSDSTVESPLSMVDDEDSLTMSPESATSLVDSPMRSPGLA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagacggtggcgtttcttgtctacgaaggtcggagatgatcggtataggaatc
ggagaacttgaatctccgccgctagattctgatcaagtccacgttctcgccgttgatgac
agcctagttgatcgaatagtcatcgaaagattgcttcgaatcacatcctgcaaagtcacg
gcggttgatagcggatggcgtgctctcgaattcttaggattagacgacgacaaagccgcc
gtcgaattcgatagattgaaggtggatttgatcatcactgattactgtatgcctggaatg
actggatacgagcttctgaaaaagattaaggaatcgacaagttttaaggaagttcctgtt
gtaattatgtcgtcggagaatgtaatgactcgtatcgacagatgtcttgaagaaggtgcg
gaggattttttactaaaaccggtgaaactcgccgacgtgaaacgtctgaggagttacttg
acgagagacgttaaagtcgccgccgaaggaaacaaacggaagctgaccactccaccgccg
ccgcctccgctctcagccacatcctcgatggaatcttcggactctacggtggaatcgcct
ctgtctatggttgacgatgaagattcgttgacaatgtcgccggagtctgcaacttcgctt
gtggattcgccgatgaggagtcccggattagcttag

DBGET integrated database retrieval system