KEGG   Arabidopsis thaliana (thale cress): AT1G60880Help
Entry
AT1G60880         CDS       T00041                                 

Gene name
AGL56
Definition
(RefSeq) protein agamous-like 56
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 201 aa AA seqDB search
MGGKKTKIEIKKIINKPAKTVAFTKRREGLFRKASQLCLLSPATQIAILAAPMTSKSHAS
FYSFGHSSVDNVVSSLLYDHPPLTANQDNRSGLGFWWEDKRFDVSENVEELKEAVDAVSR
MLNNVRCRLNDAVKSTQRDGGLEILHHQEEEVLQTRNDETKTNQTHEFEGGETSGSASWL
ENEDDILHFDDDFYTGIDPLF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcaaaaaaacaaagattgagattaagaagatcataaacaaacccgcaaaaacg
gttgctttcacaaaacgcagggaaggtctcttccgcaaagcttcacagctttgtctcctc
tctccagccactcaaatcgcaatcttagcggctcctatgacttccaaatctcacgcttct
ttctactctttcggtcattcctctgtcgataacgttgtctcctctctgctttatgaccat
cctcctcttacggcaaaccaagacaacaggtcagggttagggttttggtgggaagacaaa
cgttttgacgtatcggagaacgttgaggagttaaaagaggcggtcgatgctgtttcgagg
atgttgaacaatgtgagatgccgattaaatgatgccgtgaagagtactcaaagagatgga
ggtttagagattcttcatcatcaggaggaggaagttcttcagactcgcaacgacgagaca
aagacgaatcaaactcacgaatttgaaggcggcgaaacttctggttctgcaagttggtta
gagaacgaggatgatattcttcactttgatgatgatttttatactggtattgatcctttg
ttttga

DBGET integrated database retrieval system