KEGG   Arabidopsis thaliana (thale cress): AT1G60880Help
Entry
AT1G60880         CDS       T00041                                 

Gene name
AGL56
Definition
(RefSeq) AGAMOUS-like-56
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: SRF-TF CTXphi_pIII-N1
Motif
Other DBs
NCBI-GeneID: 842380
NCBI-ProteinID: NP_176285
MIPS: AT1G60880.1
TAIR: AT1G60880
Araport: AT1G60880
UniProt: Q9C963 A0A178W6G0
Position
1
AA seq 201 aa AA seqDB search
MGGKKTKIEIKKIINKPAKTVAFTKRREGLFRKASQLCLLSPATQIAILAAPMTSKSHAS
FYSFGHSSVDNVVSSLLYDHPPLTANQDNRSGLGFWWEDKRFDVSENVEELKEAVDAVSR
MLNNVRCRLNDAVKSTQRDGGLEILHHQEEEVLQTRNDETKTNQTHEFEGGETSGSASWL
ENEDDILHFDDDFYTGIDPLF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcaaaaaaacaaagattgagattaagaagatcataaacaaacccgcaaaaacg
gttgctttcacaaaacgcagggaaggtctcttccgcaaagcttcacagctttgtctcctc
tctccagccactcaaatcgcaatcttagcggctcctatgacttccaaatctcacgcttct
ttctactctttcggtcattcctctgtcgataacgttgtctcctctctgctttatgaccat
cctcctcttacggcaaaccaagacaacaggtcagggttagggttttggtgggaagacaaa
cgttttgacgtatcggagaacgttgaggagttaaaagaggcggtcgatgctgtttcgagg
atgttgaacaatgtgagatgccgattaaatgatgccgtgaagagtactcaaagagatgga
ggtttagagattcttcatcatcaggaggaggaagttcttcagactcgcaacgacgagaca
aagacgaatcaaactcacgaatttgaaggcggcgaaacttctggttctgcaagttggtta
gagaacgaggatgatattcttcactttgatgatgatttttatactggtattgatcctttg
ttttga

DBGET integrated database retrieval system