KEGG   Arabidopsis thaliana (thale cress): AT1G62360Help
Entry
AT1G62360         CDS       T00041                                 

Gene name
STM
Definition
(RefSeq) KNOX/ELK homeobox transcription factor
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: KNOX1 KNOX2 Homeobox_KN ELK Homeobox
Motif
Other DBs
NCBI-GeneID: 842534
NCBI-ProteinID: NP_176426
MIPS: AT1G62360.1
TAIR: AT1G62360
Araport: AT1G62360
UniProt: Q38874 A0A178WBW0
Position
1
AA seq 382 aa AA seqDB search
MESGSNSTSCPMAFAGDNSDGPMCPMMMMMPPIMTSHQHHGHDHQHQQQEHDGYAYQSHH
QQSSSLFLQSLAPPQGTKNKVASSSSPSSCAPAYSLMEIHHNEIVAGGINPCSSSSSSAS
VKAKIMAHPHYHRLLAAYVNCQKVGAPPEVVARLEEACSSAAAAAASMGPTGCLGEDPGL
DQFMEAYCEMLVKYEQELSKPFKEAMVFLQRVECQFKSLSLSSPSSFSGYGETAIDRNNN
GSSEEEVDMNNEFVDPQAEDRELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLL
DWWSRHYKWPYPSEQQKLALAESTGLDQKQINNWFINQRKRHWKPSEDMQFVVMDATHPH
HYFMDNVLGNPFPMDHISSTML
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggagagtggttccaacagcacttcttgtccaatggcttttgccggggataatagtgat
ggtccgatgtgtcctatgatgatgatgatgccgcccatcatgacatcacatcaacatcat
ggtcatgatcatcaacatcaacaacaagaacatgatggttatgcatatcagtcacaccac
caacaaagtagttccctttttcttcaatcactagctcctccccaaggaactaagaacaaa
gttgcttcttcttcttctccttcctcttgtgctcctgcctattctctaatggagatccat
cataacgaaatcgttgcaggaggaatcaacccttgctcctcttcctcttcttcagcctct
gtcaaggccaagatcatggctcatcctcactaccaccgcctcttggccgcttatgtcaat
tgtcagaaggttggagcaccaccggaggttgtggcgaggctagaggaggcatgctcgtct
gccgcagccgctgccgcatctatgggaccaacaggatgtctaggtgaagatccagggctt
gatcaattcatggaagcttactgtgaaatgctcgttaagtatgagcaagagctctccaaa
cctttcaaggaagctatggtcttccttcaacgtgtcgagtgtcaattcaaatccctctct
ctatcctcaccttcctctttctccggttatggagagacagcaattgataggaacaataat
gggtcatccgaggaagaagtcgatatgaacaatgaatttgtagatccacaagctgaggat
agagagcttaaaggacagctcttgcgcaagtacagtggttacttagggagcctcaagcaa
gagttcatgaagaagaggaagaaaggaaagctccctaaagaagctcgtcaacaactgctt
gattggtggagccgtcactacaaatggccttacccttcggagcaacaaaagctcgccctt
gcggaatcaacggggctggaccagaaacagataaacaattggttcataaaccagaggaaa
cggcattggaagccgtcggaggacatgcagtttgtagtaatggacgcaacacatcctcac
cattacttcatggataatgtcttgggcaatcctttcccaatggatcacatctcctccacc
atgctttga

DBGET integrated database retrieval system