KEGG   Arabidopsis thaliana (thale cress): AT1G63150Help
Entry
AT1G63150         CDS       T00041                                 

Definition
(RefSeq) Tetratricopeptide repeat (TPR)-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR_2 PPR_1 PPR PPR_3 PPR_long MRP-S27 ATP13 AEP1
Motif
Other DBs
NCBI-GeneID: 842619
NCBI-ProteinID: NP_001323422
MIPS: AT1G63150.1
TAIR: AT1G63150
Araport: AT1G63150
UniProt: Q9CAM8
Position
1
AA seq 629 aa AA seqDB search
MQRSISLTAKRLFVHWNLQGIGNPPTVPSFFNLCGSGCWERSFASASGDYREILRNRLSD
IIKVDDAVDLFGDMVKSRPFPSIVEFNKLLSAVAKMNKFELVISLGEQMQTLGISHDLYT
YSIFINCFCRRSQLSLALAVLAKMMKLGYEPDIVTLSSLLNGYCHSKRISDAVALVDQMV
EMGYKPDTFTFTTLIHGLFLHNKASEAVALVDQMVQRGCQPDLVTYGTVVNGLCKRGDID
LALNLLNKMEAARIKANVVIFNTIIDSLCKYRHVEVAVDLFTEMETKGIRPNVVTYNSLI
NCLCNYGRWSDASRLLSNMLEKKINPNVVTFNALIDAFFKEGKLVEAEKLHEEMIQRSID
PDTITYNLLINGFCMHNRLDEAKQMFKFMVSKDCLPNIQTYNTLINGFCKCKRVEDGVEL
FREMSQRGLVGNTVTYTTIIQGFFQAGDCDSAQMVFKQMVSNRVPTDIMTYSILLHGLCS
YGKLDTALVIFKYLQKSEMELNIFIYNTMIEGMCKAGKVGEAWDLFCSLSIKPDVVTYNT
MISGLCSKRLLQEADDLFRKMKEDGTLPNSGTYNTLIRANLRDCDRAASAELIKEMRSSG
FVGDASTISLVTNMLHDGRLDKSFLNMLS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgcagagatcgatttcattgacggccaaaagattgtttgttcattggaatctccagggg
ataggtaatcctccaactgttccttctttcttcaatctttgcggttccggttgctgggaa
cgatcttttgctagtgctagtggtgattacagagagatattgagaaataggctaagtgat
attattaaggtagatgatgcggttgatctgttcggtgacatggtcaagtctcgtccattt
ccttccattgttgaattcaataaactgttgagtgccgttgctaagatgaacaagtttgaa
cttgtcatctctctcggcgagcagatgcaaactttgggaatttcacatgatctttacaca
tacagtattttcatcaactgcttttgccgacgctctcagctctctcttgctttagctgtt
cttgccaagatgatgaaactcggctatgagcccgatattgtcacgctttcttcgctgctc
aatggctactgtcacagtaagaggatttctgatgccgtagctttggttgatcaaatggtc
gaaatgggatataaacctgatacctttacattcacaactctaattcatggactttttctt
cacaacaaagcttcagaagcagtggctttagttgatcaaatggttcaaagaggatgtcaa
ccagatctggttacttatggtaccgtagtaaacggattatgtaagagaggtgatattgat
ttggctttaaatctgctcaacaagatggaagctgcgagaataaaggctaatgttgtgatc
ttcaacacaatcatcgatagtctctgcaaatatagacatgtggaagttgctgttgactta
ttcactgaaatggaaaccaaaggaattagacctaatgttgtcacctacaattccctcatt
aattgcctttgtaattacggaagatggagtgatgcctctcgactactgagtaatatgctt
gagaagaaaatcaaccccaatgttgttactttcaatgcattgatcgatgcgttttttaaa
gaggggaagcttgtagaggctgaaaaattgcacgaggagatgatccaaaggtctatagat
ccagatactatcacttacaatttattgatcaatgggttttgcatgcacaatcgcctagac
gaggccaagcagatgtttaagttcatggttagcaaggactgtcttccaaatatacagact
tataatacgcttataaatggattttgtaagtgtaaaagggttgaggatggtgtggaactc
ttccgcgagatgtctcaaaggggattagttggcaacacagtcacttacaccactattatc
caagggttttttcaagctggcgactgtgattctgcccaaatggtattcaaacagatggtt
tctaatcgtgtgcctacagatattatgacatacagcattttgttgcatggactttgtagt
tatgggaagctagatacagcattggtcatattcaagtatctgcaaaagagtgaaatggaa
cttaatatttttatatataatactatgattgaagggatgtgcaaggctggcaaggtggga
gaagcgtgggatttattttgtagcctcagcattaagcctgatgttgtaacatacaataca
atgatctcaggattgtgtagtaaacgcctactacaggaagcagatgacctgttcagaaaa
atgaaagaagatggtactcttccaaatagtggtacatataatacgcttatcagagcaaac
cttagagattgtgacagagccgcatcagcagaactcatcaaagaaatgaggagttctggg
tttgttggagatgcttcaaccattagcttggtgacaaatatgttgcatgatgggagattg
gacaaaagctttctcaatatgctttcttaa

DBGET integrated database retrieval system