KEGG   Arabidopsis thaliana (thale cress): AT1G63460Help
Entry
AT1G63460         CDS       T00041                                 

Gene name
GPX8
Definition
glutathione peroxidase 8
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AT1G63460 (GPX8)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AT1G63460 (GPX8)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AT1G63460 (GPX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 167 aa AA seqDB search
MATKEPESVYELSIEDAKGNNLALSQYKDKVLLIVNVASKCGMTNSNYTELNELYNRYKD
KGLEILAFPCNQFGDEEPGTNDQITDFVCTRFKSEFPIFNKIEVNGENASPLYKFLKKGK
WGIFGDDIQWNFAKFLVDKNGQAVQRYYPTTSPLTLEHDIKNLLNIS
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaaggaaccagaatctgtttacgagttaagcatcgaggatgcaaaagggaac
aacttagcactcagtcaatacaaagacaaagttcttttaattgtcaatgttgcttccaaa
tgtgggatgacaaactcaaactacactgaattgaatgagctttacaacaggtataaagat
aaaggtctggagattctagcatttccttgtaaccagtttggtgacgaggaaccgggaact
aatgaccaaattactgactttgtttgtactcgcttcaaatctgaattccccattttcaac
aagattgaagtaaacggagagaatgcttctcctctgtataagttcctgaagaaaggcaaa
tggggaatcttcggcgatgacattcaatggaactttgctaagtttcttgttgacaaaaac
ggtcaagctgtacaacgttattatccaactacttcccctcttacacttgagcatgacata
aagaatcttctgaatatctcctga

DBGET integrated database retrieval system