KEGG   Arabidopsis thaliana (thale cress): AT1G63630Help
Entry
AT1G63630         CDS       T00041                                 

Definition
(RefSeq) Tetratricopeptide repeat (TPR)-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR_2 PPR_1 PPR PPR_3 PPR_long MRP-S27 AEP1
Motif
Other DBs
NCBI-GeneID: 842667
NCBI-ProteinID: NP_001319309
MIPS: AT1G63630.1
TAIR: AT1G63630
Araport: AT1G63630
UniProt: Q6DR07
Position
1
AA seq 152 aa AA seqDB search
MLRWSIFPTTITYNSMIDGFCKQDRVDDAKRMLDSMASKGCSPDVVTFSTLINGYCKAKR
VDNGMEIFCEMHRRGIVANTVTYTTLIHGFCQVGDLDAAQDLLNEMISCGVAPDYITFHC
MLAGLCSKKELRKAFAILEDLQKSEDHHLEDE
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgttggagtatatttcctaccacaatcacatataactcaatgatcgatggattt
tgcaagcaggatcgtgtagatgatgcaaagcgcatgttagattcgatggctagcaagggc
tgctctccggatgtagtcacttttagcaccctaatcaatggctattgtaaggctaaaagg
gttgacaatggaatggagattttctgtgagatgcatcgaagaggaatagttgctaataca
gttacttacactactttgattcatgggttttgtcaagtgggtgatctcgatgccgctcaa
gaccttctcaatgagatgatttcttgtggtgtggctccagattacatcactttccactgt
atgctggccggcttatgcagtaagaaagaattacgaaaagcatttgcaatattggaggat
ctgcagaagagtgaggatcatcatttggaggatgaatga

DBGET integrated database retrieval system