KEGG   Arabidopsis thaliana (thale cress): AT1G64230Help
Entry
AT1G64230         CDS       T00041                                 

Gene name
UBC28
Definition
(RefSeq) ubiquitin-conjugating enzyme E2 28
  KO
K06689  
ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AT1G64230 (UBC28)
   04120 Ubiquitin mediated proteolysis
    AT1G64230 (UBC28)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     AT1G64230 (UBC28)
Ubiquitin system [BR:ath04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   AT1G64230 (UBC28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 148 aa AA seqDB search
MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDY
PFKPPKVAFRTKVFHPNVNSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV
PEIAHMYKTDRAKYESTARSWTQKYAMG
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgaaaaggatcttgaaagagctcaaggatctccagaaggatcctccaacttcc
tgcagtgctggcccagttgctgaagacatgtttcattggcaagctacaataatgggtcca
tctgatagtccttattcaggcggtgtctttctcgtaaccattcacttccctccggattat
cctttcaaaccaccaaaggttgcattcaggacaaaagtgttccaccctaatgtcaacagc
aatggaagcatttgccttgacattttgaaagaacaatggagtcctgcactcaccatatcg
aaggttttgctttcgatatgttcattgttaacggacccaaacccagatgatccattggtt
ccagagattgctcacatgtacaaaaccgatagagcaaagtatgagtctactgcgagaagc
tggactcagaaatatgcaatgggatga

DBGET integrated database retrieval system