KEGG   Arabidopsis thaliana (thale cress): AT1G64710Help
Entry
AT1G64710         CDS       T00041                                 

Definition
(RefSeq) alcohol dehydrogenase-like 4
  KO
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT1G64710
  Lipid metabolism
   00071 Fatty acid degradation
    AT1G64710
  Amino acid metabolism
   00350 Tyrosine metabolism
    AT1G64710
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AT1G64710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 396 aa AA seqDB search
MQFQLSKPANNKQRRNMETQGKVITCKAAVAWGAGEPLVMEDVKVDPPQRLEVRIRILFT
SICHTDLSAWKGENEAQRAYPRILGHEAAGIVESVGEGVEEMMAGDHVLPIFTGECGDCR
VCKRDGANLCERFRVDPMKKVMVTDGKTRFFTSKDNKPIYHFLNTSTFSEYTVIDSACVL
KVDPLFPLEKISLLSCGVSTGVGAAWNVADIQPASTVAIFGLGAVGLAVAEGARARGASK
IIGIDINPDKFQLGREAGISEFINPKESDKAVHERVMEITEGGVEYSFECAGSIEALREA
FLSTNSGVGVTVMLGVHASPQLLPIHPMELFQGRSITASVFGGFKPKTQLPFFITQCLQG
LLNLDLFISHQLPFHDINEAMQLLHQGKALRCLLHL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttcaactttcaaagccagcaaataataaacagaggagaaatatggaaacacaa
ggcaaagtaatcacttgcaaagctgctgtggcatggggagctggagagcctctagtaatg
gaagatgtaaaagtggatcctcctcaaagattggaagtgagaattcgaatcctcttcact
tccatctgtcacactgatctcagcgcatggaaaggcgagaacgaggctcagcgagcatac
cctcgaatccttggccatgaggcagcagggatagtggagagcgtaggggaaggtgtggaa
gagatgatggcaggagatcatgtgctccctattttcacaggagagtgtggagactgcaga
gtgtgcaagcgagacggagccaatctgtgcgagagattccgagtggatccgatgaagaag
gtgatggtaaccgatggaaagaccagattcttcaccagcaaagacaacaaaccaatctac
cattttctcaacacatccaccttctccgagtacacggtcatagactcggcctgcgtgctc
aaggtggaccctctgtttcctctggagaagataagcctcctcagctgcggtgtctccact
ggagtcggtgcggcgtggaatgtggctgatattcaacctgcctccaccgtcgctattttt
ggacttggcgctgttggacttgccgtggctgaaggtgcaagagccagaggagcctctaaa
atcattgggatcgacatcaaccctgacaagttccaactaggcagagaagcagggattagt
gaattcataaatccaaaggagagtgacaaggcagttcatgagagagtaatggagataaca
gagggaggagtggagtacagcttcgagtgtgcaggaagtatagaagcacttagagaagcc
tttctgtctacaaactcaggagtgggagtgactgtcatgctgggcgttcacgcaagccca
cagcttctccctatccatcccatggagctcttccaaggcagatccatcaccgcctctgtt
ttcggaggcttcaaacccaaaacccaattaccctttttcatcacccagtgcctccaaggt
cttctcaatctcgatctcttcatctctcaccagcttcccttccacgatatcaacgaagcc
atgcagctgcttcaccaaggcaaagctcttcgttgccttctccacctctaa

DBGET integrated database retrieval system