KEGG   Arabidopsis thaliana (thale cress): AT1G65930Help
Entry
AT1G65930         CDS       T00041                                 

Gene name
cICDH
Definition
(RefSeq) NADP+-dependent isocitrate dehydrogenase
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Peroxisome
Module
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT1G65930 (cICDH)
   01210 2-Oxocarboxylic acid metabolism
    AT1G65930 (cICDH)
   01230 Biosynthesis of amino acids
    AT1G65930 (cICDH)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AT1G65930 (cICDH)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AT1G65930 (cICDH)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    AT1G65930 (cICDH)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AT1G65930 (cICDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 410 aa AA seqDB search
MAFEKIKVANPIVEMDGDEMTRVIWKSIKDKLITPFVELDIKYFDLGLPHRDATDDKVTI
ESAEATKKYNVAIKCATITPDEGRVTEFGLKQMWRSPNGTIRNILNGTVFREPIICKNVP
KLVPGWTKPICIGRHAFGDQYRATDAVIKGPGKLTMTFEGKDGKTETEVFTFTGEGGVAM
AMYNTDESIRAFADASMNTAYEKKWPLYLSTKNTILKKYDGRFKDIFQEVYEASWKSKYD
AAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDG
KTIEAEAAHGTVTRHFRVHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLE
AACVGTVESGKMTKDLALIIHGSKLSRDTYLNTEEFIDAVAAELKERLNA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttgagaagatcaaggtggcaaatcccatcgtcgagatggatggtgatgaaatg
accagggttatttggaagtctatcaaggataagcttattactccttttgtggagttggat
atcaagtacttcgaccttggtcttcctcaccgtgatgctacggatgacaaagttactatt
gaaagtgctgaagctactaagaagtacaatgtggcgatcaagtgtgccaccatcactcca
gatgaaggccgtgtcacggaatttggcttgaagcagatgtggagaagtccaaatgggacc
atcaggaatatcctgaatggaactgtatttagagagccaattatctgcaaaaatgttccc
aagcttgtcccaggctggacaaagcccatctgcattggaaggcatgcttttggtgatcag
taccgtgccactgatgctgtaatcaagggaccaggaaaactgactatgacctttgaggga
aaagatgggaaaactgaaaccgaagtctttacatttactggtgaaggtggtgttgctatg
gcaatgtacaacactgatgagtccatccgtgcttttgctgatgcatcgatgaacactgct
tatgagaaaaagtggccactttaccttagcacaaagaataccattcttaagaaatacgat
ggcagattcaaagacatcttccaagaagtctatgaagccagctggaagtcgaagtatgat
gctgctggaatctggtatgaacaccgtctcattgatgatatggtggcctacgctcttaag
agtgagggaggctatgtttgggcatgcaaaaactatgatggtgatgtccaaagtgatttc
ttggcacaaggattcgggtcacttggattgatgacatctgttctggtctgcccagatgga
aagacgattgaagctgaagcggcccatggaactgtcacccgtcacttcagggttcatcag
aaaggtggtgagaccagcacaaacagcatagcctctatttttgcttggactcgtggactt
gcacacagggctaagttagatgacaacgcaaaactcttggatttcactgagaagctggaa
gccgcttgtgttgggacagtggagtcagggaaaatgaccaaagatcttgcactcatcatt
cacggctcaaagctttcgagggacacgtacctgaacacagaggagttcatcgatgcagtc
gctgctgagctcaaagaaagactcaatgcttaa

DBGET integrated database retrieval system