KEGG   Arabidopsis thaliana (thale cress): AT1G65930Help
Entry
AT1G65930         CDS       T00041                                 

Gene name
cICDH
Definition
(RefSeq) cytosolic NADP+-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00020  Citrate cycle (TCA cycle)
ath00480  Glutathione metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01210  2-Oxocarboxylic acid metabolism
ath01230  Biosynthesis of amino acids
ath04146  Peroxisome
Module
ath_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AT1G65930 (cICDH)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AT1G65930 (cICDH)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    AT1G65930 (cICDH)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AT1G65930 (cICDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh DUF3845
Motif
Other DBs
NCBI-GeneID: 842905
NCBI-ProteinID: NP_176768
MIPS: AT1G65930.1
TAIR: AT1G65930
Araport: AT1G65930
UniProt: Q9SRZ6 A0A178W7K0
Position
1
AA seq 410 aa AA seqDB search
MAFEKIKVANPIVEMDGDEMTRVIWKSIKDKLITPFVELDIKYFDLGLPHRDATDDKVTI
ESAEATKKYNVAIKCATITPDEGRVTEFGLKQMWRSPNGTIRNILNGTVFREPIICKNVP
KLVPGWTKPICIGRHAFGDQYRATDAVIKGPGKLTMTFEGKDGKTETEVFTFTGEGGVAM
AMYNTDESIRAFADASMNTAYEKKWPLYLSTKNTILKKYDGRFKDIFQEVYEASWKSKYD
AAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDG
KTIEAEAAHGTVTRHFRVHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLE
AACVGTVESGKMTKDLALIIHGSKLSRDTYLNTEEFIDAVAAELKERLNA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttgagaagatcaaggtggcaaatcccatcgtcgagatggatggtgatgaaatg
accagggttatttggaagtctatcaaggataagcttattactccttttgtggagttggat
atcaagtacttcgaccttggtcttcctcaccgtgatgctacggatgacaaagttactatt
gaaagtgctgaagctactaagaagtacaatgtggcgatcaagtgtgccaccatcactcca
gatgaaggccgtgtcacggaatttggcttgaagcagatgtggagaagtccaaatgggacc
atcaggaatatcctgaatggaactgtatttagagagccaattatctgcaaaaatgttccc
aagcttgtcccaggctggacaaagcccatctgcattggaaggcatgcttttggtgatcag
taccgtgccactgatgctgtaatcaagggaccaggaaaactgactatgacctttgaggga
aaagatgggaaaactgaaaccgaagtctttacatttactggtgaaggtggtgttgctatg
gcaatgtacaacactgatgagtccatccgtgcttttgctgatgcatcgatgaacactgct
tatgagaaaaagtggccactttaccttagcacaaagaataccattcttaagaaatacgat
ggcagattcaaagacatcttccaagaagtctatgaagccagctggaagtcgaagtatgat
gctgctggaatctggtatgaacaccgtctcattgatgatatggtggcctacgctcttaag
agtgagggaggctatgtttgggcatgcaaaaactatgatggtgatgtccaaagtgatttc
ttggcacaaggattcgggtcacttggattgatgacatctgttctggtctgcccagatgga
aagacgattgaagctgaagcggcccatggaactgtcacccgtcacttcagggttcatcag
aaaggtggtgagaccagcacaaacagcatagcctctatttttgcttggactcgtggactt
gcacacagggctaagttagatgacaacgcaaaactcttggatttcactgagaagctggaa
gccgcttgtgttgggacagtggagtcagggaaaatgaccaaagatcttgcactcatcatt
cacggctcaaagctttcgagggacacgtacctgaacacagaggagttcatcgatgcagtc
gctgctgagctcaaagaaagactcaatgcttaa

DBGET integrated database retrieval system