KEGG   Arabidopsis thaliana (thale cress): AT1G66280Help
Entry
AT1G66280         CDS       T00041                                 

Gene name
BGLU22
Definition
(RefSeq) Glycosyl hydrolase superfamily protein
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00460  Cyanoamino acid metabolism
ath00500  Starch and sucrose metabolism
ath00940  Phenylpropanoid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT1G66280 (BGLU22)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AT1G66280 (BGLU22)
  Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT1G66280 (BGLU22)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     AT1G66280 (BGLU22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 DUF1256
Motif
Other DBs
NCBI-GeneID: 842945
NCBI-ProteinID: NP_176802
MIPS: AT1G66280.1
TAIR: AT1G66280
Araport: AT1G66280
UniProt: Q9C8Y9
Position
1
AA seq 524 aa AA seqDB search
MALQKFPLLGLLFLITIVVSSTIAVDDPVCPTTSKLSRASFPNGFVFGTATAAFQVEGAI
NETCRGPALWDIFCKRNPERCSGHNADVAVDFFHRYKEDIQLMKNLNTDAFRLSIAWSRI
FPHGRKEKGVSQAGVKFYHDLIDELLKNGIIPFVTVFHWDTPQDLEDEYGGFLSENIVKD
FREYADYVFTEYGGKVKNWITFNEPWVFAHAGYDVGKKAPGRCSRYLKGCEDRDGRSGYE
AYLVSHNLLNAHAEAVEVFRQKVKGGKIGIAHSPAWFEPHDLKDSNDVPTVSRVLDFMLG
WHLDPTTFGDYPQIMKDLLGHRLPKFTSSQKAKLKDSTDFVGLNYYTSTFSNHNEKPDPS
TPSWKQDSLVAWEPKNVDHSAIGSQPLTAALPVYAKGFRSLLKYIKDKYANPEIMIMENG
YGDKLKDKDSVEVGTADYNRKYYLQRHLLAMNEAICIDKVRVTGYFVWSLLDNFEWQDGY
NNRFGLYYVDFKNNLTRYEKESAKYYKDFLGQGVRPSALKKDEL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggcattgcaaaagttccctctcctggggcttctttttctcataaccattgtcgtctct
tcgacaatagccgtcgatgatcctgtgtgcccaacgacgtccaaactaagccgagcaagt
ttccctaatgggtttgtgtttggcacagctactgctgcgtttcaggttgaaggtgcaatt
aatgaaacttgtcgtggacctgctctatgggatatcttctgtaagagaaatccagagaga
tgtagtggccacaacgccgatgtggccgttgatttcttccatcgttataaggaagatatt
caactaatgaagaatctaaacacagacgcattcagactctcaatcgcatggtcaagaata
tttcctcatgggagaaaggagaagggagtgagtcaagctggtgtgaaattctaccacgac
ctgatcgatgagctccttaaaaatggtataattccgtttgtgactgttttccattgggac
actccacaagatttagaagacgaatatggcggtttcttaagcgagaacattgtgaaagat
ttccgagaatatgcagattatgttttcactgaatacggtggaaaagtgaaaaactggatc
actttcaacgagccatgggtcttcgctcatgcaggttacgacgtaggcaagaaggcgcca
ggacgttgttctcgctaccttaaaggttgtgaagaccgagatggacgatcaggttatgag
gcttatctagttagtcacaacctcctcaacgctcatgcagaagctgttgaagttttccgc
caaaaggttaaaggtgggaaaattggaatcgcacatagtccggcttggttcgaaccacat
gatcttaaagattcaaatgacgttccaactgttagccgtgtacttgactttatgttggga
tggcatctagacccaactacttttggagattatccacaaatcatgaaagaccttcttggt
cacagattgcccaaattcacttcttcacaaaaagcaaaattgaaagattcgaccgatttc
gtagggcttaactactatacttcaacattttcaaaccataatgaaaagccagatccgtct
acaccaagttggaagcaagattctcttgttgcttgggaacctaagaatgtagatcacagc
gccattggtagccagcctcttaccgctgcattgcccgtctacgctaaaggttttagaagt
cttttaaagtacatcaaagataaatacgcaaacccggaaattatgatcatggaaaatgga
tatggagataaacttaaggacaaagattcggttgaggttggtactgctgattataacagg
aaatactatcttcagaggcatcttctagctatgaacgaagctatttgcattgacaaagtg
agagttacgggatactttgtatggtcattattagataactttgaatggcaagatggttat
aataacagattcggactctattacgtcgatttcaaaaataacctcacacgttatgagaaa
gaatcagccaagtactacaaagatttcctcggtcaaggtgttcgtccatccgcgctcaag
aaggatgagctttaa

DBGET integrated database retrieval system