KEGG   Arabidopsis thaliana (thale cress): AT1G66340Help
Entry
AT1G66340         CDS       T00041                                 

Gene name
ETR1
Definition
(RefSeq) ethylene receptor 1
  KO
K14509  
ethylene receptor [EC:2.7.13.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    AT1G66340 (ETR1)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.-  
     AT1G66340 (ETR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
1
AA seq 738 aa AA seqDB search
MEVCNCIEPQWPADELLMKYQYISDFFIAIAYFSIPLELIYFVKKSAVFPYRWVLVQFGA
FIVLCGATHLINLWTFTTHSRTVALVMTTAKVLTAVVSCATALMLVHIIPDLLSVKTREL
FLKNKAAELDREMGLIRTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLALEECA
LWMPTRTGLELQLSYTLRHQHPVEYTVPIQLPVINQVFGTSRAVKISPNSPVARLRPVSG
KYMLGEVVAVRVPLLHLSNFQINDWPELSTKRYALMVLMLPSDSARQWHVHELELVEVVA
DQVAVALSHAAILEESMRARDLLMEQNVALDLARREAETAIRARNDFLAVMNHEMRTPMH
AIIALSSLLQETELTPEQRLMVETILKSSNLLATLMNDVLDLSRLEDGSLQLELGTFNLH
TLFREVLNLIKPIAVVKKLPITLNLAPDLPEFVVGDEKRLMQIILNIVGNAVKFSKQGSI
SVTALVTKSDTRAADFFVVPTGSHFYLRVKVKDSGAGINPQDIPKIFTKFAQTQSLATRS
SGGSGLGLAISKRFVNLMEGNIWIESDGLGKGCTAIFDVKLGISERSNESKQSGIPKVPA
IPRHSNFTGLKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSHEHKVVFMDV
CMPGVENYQIALRIHEKFTKQRHQRPLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDN
IRDVLSDLLEPRVLYEGM
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggaagtctgcaattgtattgaaccgcaatggccagcggatgaattgttaatgaaatac
caatacatctccgatttcttcattgcgattgcgtatttttcgattcctcttgagttgatt
tactttgtgaagaaatcagccgtgtttccgtatagatgggtacttgttcagtttggtgct
tttatcgttctttgtggagcaactcatcttattaacttatggactttcactacgcattcg
agaaccgtggcgcttgtgatgactaccgcgaaggtgttaaccgctgttgtctcgtgtgct
actgcgttgatgcttgttcatattattcctgatcttttgagtgttaagactcgggagctt
ttcttgaaaaataaagctgctgagctcgatagagaaatgggattgattcgaactcaggaa
gaaaccggaaggcatgtgagaatgttgactcatgagattagaagcactttagatagacat
actattttaaagactacacttgttgagcttggtaggacattagctttggaggagtgtgca
ttgtggatgcctactagaactgggttagagctacagctttcttatacacttcgtcatcaa
catcccgtggagtatacggttcctattcaattaccggtgattaaccaagtgtttggtact
agtagggctgtaaaaatatctcctaattctcctgtggctaggttgagacctgtttctggg
aaatatatgctaggggaggtggtcgctgtgagggttccgcttctccacctttctaatttt
cagattaatgactggcctgagctttcaacaaagagatatgctttgatggttttgatgctt
ccttcagatagtgcaaggcaatggcatgtccatgagttggaactcgttgaagtcgtcgct
gatcaggtggctgtagctctctcacatgctgcgatcctagaagagtcgatgcgagctagg
gaccttctcatggagcagaatgttgctcttgatctagctagacgagaagcagaaacagca
atccgtgcccgcaatgatttcctagcggttatgaaccatgaaatgcgaacaccgatgcat
gcgattattgcactctcttccttactccaagaaacggaactaacccctgaacaaagactg
atggtggaaacaatacttaaaagtagtaaccttttggcaactttgatgaatgatgtctta
gatctttcaaggttagaagatggaagtcttcaacttgaacttgggacattcaatcttcat
acattatttagagaggtcctcaatctgataaagcctatagcggttgttaagaaattaccc
atcacactaaatcttgcaccagatttgccagaatttgttgttggggatgagaaacggcta
atgcagataatattaaatatagttggtaatgctgtgaaattctccaaacaaggtagtatc
tccgtaaccgctcttgtcaccaagtcagacacacgagctgctgacttttttgtcgtgcca
actgggagtcatttctacttgagagtgaaggtaaaagactctggagcaggaataaatcct
caagacattccaaagattttcactaaatttgctcaaacacaatctttagcgacgagaagc
tcgggtggtagtgggcttggcctcgccatctccaagaggtttgtgaatctgatggagggt
aacatttggattgagagcgatggtcttggaaaaggatgcacggctatctttgatgttaaa
cttgggatctcagaacgttcaaacgaatctaaacagtcgggcataccgaaagttccagcc
attccccgacattcaaatttcactggacttaaggttcttgtcatggatgagaacggggta
agtagaatggtgacgaagggacttcttgtacaccttgggtgcgaagtgaccacggtgagt
tcaaacgaggagtgtctccgagttgtgtcccatgagcacaaagtggtcttcatggacgtg
tgcatgcccggggtcgaaaactaccaaatcgctctccgtattcacgagaaattcacaaaa
caacgccaccaacggccactacttgtggcactcagtggtaacactgacaaatccacaaaa
gagaaatgcatgagctttggtctagacggtgtgttgctcaaacccgtatcactagacaac
ataagagatgttctgtctgatcttctcgagccccgggtactgtacgagggcatgtaa

DBGET integrated database retrieval system