KEGG   Arabidopsis thaliana (thale cress): AT1G67220Help
Entry
AT1G67220         CDS       T00041                                 

Gene name
HAC2
Definition
histone acetyltransferase HAC2
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 1367 aa AA seqDB search
MAPPRKRTRDLMPKFLNTESFDEFNQRLNNLPAESNVTSDEDAQFLESRKCQSKRWRKEE
PLKLNLRSPWNVLCSPESISSAKFIVEKTCLIPVPSFEEAATNARRCLNTSSIPGSSGSA
SETNSGSDITKQDFKNDSPSDSKKVQGSSTSKSAKPKVIKVYSFVDLVTTTKKGNIQTEE
SSLNHEKKLGTVVDIVEPMKCDERSKEVQGSSTSKSAKPKVIKVYSFADVVTTTKKGNIQ
TEESSLNHEKKLGTVVDIIEPMKCDERSKEVQGSSTSKSAKLKVIKVYSFADVVTTTKKG
NIQTEESSLNHEKKLGTVVDIVEPMKCDERSKEVQGSSTSKSEKPKVIKVYSFADVVTTT
KKGNIQTEESSLNHEKKLGTVVDIVEPMKCDEGTKCEVTTTNKGKIHTEERSLNHEKKLG
TVVDIVEPMKCDEGSKCEVTTTNKGNTQTEERSLNHEKKLGIGVDIVEPMKCDEGTKCEV
TTTNKGKIQTEERSLNYEKKLGIGVDIVEPMKCDEENKCEVNADTFDVVIVEPMKCNKVT
KCEVNVDTTGVNIVEPMKCNEVTKCEVNVDTIGVDIVEPMKCNEESKCEVNADTMSLQKR
SKRAVSLVERFTEEEIKLHIMSLKKPSTQSAVEGMCDLKEEEESCQLCDDGTLLFPPQPL
YCLLCSRRIDDRSFYYTPGEEELSNAQHQICSPCHSRCKTKFPLCGVFIDKHKMLKRSNF
DNADTEEWVQCESCEKWQHQICGLYNKLKDEDKTAEYICPTCLLEECQSINNMALVDYTD
SGAKDLPETVLSYFLEQRLFKRLKEERYQTAKATGKSINDVPEPEGLTLRVVFSADRTLT
VNKQFASLLHKENFPSEFPYRSKVILLFQKVHGVDICIFALFVQEFGSECSQPNQRSTYI
FYLDSVKYFKPERVTFAGEALRTFVYHEVLIGYLEYCKLRGFTTSYIWACPPKIGQDYIM
YSHPKTQQTPDTKKLRKWYVSMLQKAAEQRVVMNVTNLYDRFFDSTEEYMTAARLPYFEG
SFWSNRAEIMIQDIEREGNNELQKKVKLLSRRKVKTMSYKTTGDVDVDDVKNILLMEKLE
KEVFPNKKDLMVVELNYSCTRCSKAVLSGLRWFCEKCKNLHLCESCYDAGQELPGEHIYK
RMDKEKHQLSKVQVNGVLFSTTEDNDIIQENDMFESRQAFLAFSQKHNYNFHTLRHAKHS
SMMILHHLHTSNKHHCSQNSSSLTCTACKKDVSTTIYFPCLLCPDYRACTGCYTKNRTLR
HLHIFPTLPSANRAPSRTVMVLEILNAISHALLCQHKTTKSCSYPKCHEVKALFTHNVQC
KIRKKGTRCNTCYKLWQTIRIHVYHCQDLNCPVPQCRDRKEVLIRKV
NT seq 4104 nt NT seq  +upstreamnt  +downstreamnt
atggctccaccgcgtaaaaggacaagggacttgatgcctaagtttcttaacaccgaaagt
tttgatgagttcaatcagcggttgaacaatctacctgcagagtcaaatgttacgtctgat
gaagatgcacagtttcttgaatcgagaaaatgtcagtcaaagcgatggagaaaggaagaa
ccattaaagttgaatcttcgtagtccttggaatgttttatgtagtcctgagtcgattagc
tctgctaagttcattgtggagaagacatgtttgattccagtaccaagttttgaggaggct
gctactaatgctagaagatgtttaaatacatcttctataccgggaagtagcggttctgct
tccgagacaaacagcggttctgatataacgaagcaagattttaagaacgattctccttcg
gatagtaagaaggttcagggttctagtactagcaaatctgcaaaaccgaaggtaatcaag
gtttattctttcgtggatctggttactacgacaaagaaaggaaacattcaaaccgaggaa
agttctttaaaccatgagaagaaacttggaactgttgtggatattgttgagccgatgaaa
tgtgatgaaaggagtaaggaggttcagggttctagtactagcaaatctgcaaaaccgaag
gtaatcaaggtttattctttcgcggatgtggttactacgacaaagaaaggaaacattcaa
accgaggaaagttctttgaaccatgagaagaaacttggaactgttgtggatattattgag
ccgatgaaatgtgatgaaaggagtaaggaggttcagggttctagtactagcaaatctgca
aaactgaaggtaatcaaggtttattctttcgcggatgtggttactacgacaaagaaagga
aacattcaaaccgaggaaagttctttgaaccatgagaagaaacttggaactgttgtggat
attgttgagccgatgaaatgtgatgaaaggagtaaggaggttcagggttctagtactagc
aaatctgaaaaaccgaaggtaatcaaggtttattctttcgcggatgtggttactacgaca
aagaaaggaaacattcaaaccgaggaaagttctttgaaccatgagaagaaacttggaact
gttgtggatattgttgagccgatgaaatgtgatgaagggaccaagtgtgaggttactacg
acaaacaaaggaaagattcacaccgaggaaaggtctttgaaccatgagaagaaacttgga
actgttgtggatattgttgagccgatgaaatgtgatgaagggagcaagtgtgaggttact
acgacaaacaaaggaaacactcaaaccgaggaaaggtctttgaaccatgagaagaaactt
ggtattggtgtggatattgttgagccgatgaaatgtgatgaagggaccaagtgtgaggtt
actacgacaaacaaaggaaagattcaaaccgaggaaaggtctttgaactatgagaagaaa
cttggaattggtgtggatattgttgagccgatgaaatgtgatgaagagaacaagtgtgag
gttaatgctgacacatttgatgtggttattgttgagccaatgaaatgtaataaagtgacc
aagtgtgaggttaatgttgacacaactggtgtgaatattgttgagccaatgaaatgtaat
gaagtgaccaagtgtgaggttaatgttgacacaattggtgtggatattgttgagccgatg
aaatgtaatgaagagagcaagtgtgaggttaatgctgacacaatgtctctgcaaaaacgt
agcaagagagctgtctctttggtcgaacgtttcacagaagaagagataaagctgcatata
atgagtctaaagaagccaagtacacagagcgcagtcgaaggaatgtgtgacctcaaggag
gaggaggaatcatgtcaattgtgtgacgatggcacactcttgtttccaccacaaccacta
tactgcttattatgcagccgccgcatcgatgacagatctttctattatacccctggggaa
gaagaactaagcaatgcgcaacatcaaatctgcagtccttgtcacagtagatgtaaaacc
aagttccctttatgtggagtctttatcgataaacacaaaatgcttaaaaggagtaacttt
gacaacgcagatacggaggagtgggttcaatgtgaatcttgtgaaaaatggcaacatcag
atatgtggtctctacaataagcttaaagacgaagacaaaaccgcagagtatatttgtcct
acatgtttattagaggagtgtcaaagtatcaacaacatggcactcgttgactatacggat
tctggagcaaaagatttgcctgaaactgtcctcagctactttctagagcaaaggctattc
aagcgcctcaaggaagaaagataccaaacagcaaaggctactgggaagagcatcaatgat
gtacctgaaccagagggtcttactctcagagtcgtgttttcggctgacagaaccttaact
gtcaacaaacaatttgccagtttacttcacaaagaaaactttcctagtgaattcccttac
agatcaaaggttattcttctatttcagaaagtccatggagttgatatatgcatctttgca
ttgtttgtccaagagtttggatcagaatgtagccaaccaaaccaacgcagcacatacata
ttttatctcgattctgtcaaatactttaaacctgagagagtaacattcgcaggagaagct
cttcgaactttcgtttatcatgaagtattgattggatatcttgaatattgtaagcttcga
ggtttcacgacgagttatatatgggcgtgtccacctaaaataggacaagactacataatg
tattctcatcctaagactcagcaaacacctgacactaagaagcttcgcaaatggtatgtg
tcaatgctccaaaaagcagccgagcagagggtagtgatgaatgttacaaacttgtatgat
cggttcttcgattcgacagaggaatatatgacagctgcgcggttgccttactttgaagga
tctttctggtccaatagggctgagattatgattcaagacattgaaagagaaggcaataat
gagttgcagaagaaggttaaattgctttctagaagaaaagtaaagactatgagctacaaa
actacgggtgatgttgatgttgatgatgttaaaaacattctcctgatggaaaagctggaa
aaagaggtattcccaaataagaaggatttaatggtggtggaattgaattattcatgcaca
cgctgttcgaaagccgtattatcaggattgagatggttttgcgagaagtgcaagaatctt
catttgtgtgaaagctgctatgatgcaggacaagagcttcctggagaacacatatataag
aggatggacaaagagaagcatcagctctcaaaggttcaggtgaacggcgtactgttttct
acaacagaggataatgatatcatccaagaaaacgatatgttcgaaagcagacaagcgttc
ttagctttttctcaaaagcataattacaacttccacacgcttcgacatgccaagcattct
tcgatgatgatacttcaccatcttcacacctcaaacaagcatcattgctctcaaaactct
agcagtctcacctgcacggcctgcaaaaaagatgtttcgacaacgatttacttcccttgt
ttgctctgtccggattaccgagcttgcactggatgctataccaaaaacagaacccttcgt
catcttcatattttccctacactcccttcagctaatagagcgccgtcgagaaccgtaatg
gttcttgagatattgaacgcaatatcgcatgcgcttctgtgtcagcacaagaccactaag
tcatgctcatacccgaaatgccacgaagttaaagcattgttcactcacaatgtacaatgc
aaaatcagaaagaagggaactcgttgtaatacttgctacaaattgtggcagacaataagg
attcatgtgtaccattgccaagatctcaattgccccgtaccgcagtgcagagataggaag
gaagtcttgattaggaaggtgtaa

DBGET integrated database retrieval system