KEGG   Arabidopsis thaliana (thale cress): AT1G67710Help
Entry
AT1G67710         CDS       T00041                                 

Gene name
ARR11
Definition
(RefSeq) two-component response regulator ARR11
  KO
K14491  
two-component response regulator ARR-B family
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    AT1G67710 (ARR11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 521 aa AA seqDB search
MEKSGFSPVGLRVLVVDDDPTWLKILEKMLKKCSYEVTTCGLAREALRLLRERKDGYDIV
ISDVNMPDMDGFKLLEHVGLELDLPVIMMSVDGETSRVMKGVQHGACDYLLKPIRMKELK
IIWQHVLRKKLQEVRDIEGCGYEGGADWITRYDEAHFLGGGEDVSFGKKRKDFDFEKKLL
QDESDPSSSSSKKARVVWSFELHHKFVNAVNQIGCDHKAGPKKILDLMNVPWLTRENVAS
HLQKYRLYLSRLEKGKELKCYSGGVKNADSSPKDVEVNSGYQSPGRSSYVFSGGNSLIQK
ATEIDPKPLASASLSDLNTDVIMPPKTKKTRIGFDPPISSSAFDSLLPWNDVPEVLESKP
VLYENSFLQQQPLPSQSSYVANSAPSLMEEEMKPPYETPAGGSSVNADEFLMPQDKIPTV
TLQDLDPSAMKLQEFNTEAILRSLNWELPESHHSVSLDTDLDLTWLQGERFLANTGLQFQ
DYSSSPSLLSELPAHLNWYGNERLPDPDEYSFMVDQGLFIS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaagcggcttctctcccgtcggtctaagggttcttgtcgtagacgatgatcca
acttggctcaagattctcgagaaaatgctcaagaagtgttcttacgaagtaacgacctgt
ggattagctagagaggctttgaggttgctgagggagcgtaaagatggatatgatatcgtg
atcagcgatgtgaacatgcctgacatggatggtttcaagcttcttgagcatgttggtctt
gaattagacctccctgtaataatgatgtcggtggacggcgaaacaagccgagtgatgaag
ggagtgcaacacggagcttgtgattacctcttgaagccgataagaatgaaggagttaaag
attatatggcaacatgttctgagaaagaagcttcaagaagtgagagatatcgaaggctgt
ggatacgaaggaggagcggattggatcactcgatacgatgaagcacattttcttggaggt
ggtgaagatgtttcttttgggaaaaagagaaaagactttgactttgagaagaagcttctt
caagatgagagtgatccatcatcttcttcttccaagaaagctagagttgtttggtctttt
gagcttcatcataagtttgtcaacgccgttaaccaaatcggatgcgatcacaaagctggt
cccaagaagatattggatctcatgaatgttccatggctcactagagaaaatgttgcaagc
caccttcagaaatatagactttacctgagcagattagagaaaggaaaggagctcaagtgt
tattcaggtggcgtgaagaatgcggattcatctccaaaagatgtcgaagtgaattcaggc
taccaaagccctgggaggagcagctatgtattctctggaggaaattctctgatccaaaaa
gcaacagagattgatccaaagccacttgcttcagcttctttgtctgacctcaacaccgat
gtgatcatgcctccgaaaacaaaaaagacgcgtataggatttgatcctcccatttcctcc
tctgcgtttgactctctgcttccttggaatgatgttccagaggtccttgaatcgaagccg
gttctgtatgagaatagctttctccagcaacaaccattgccaagtcaaagttcctatgtt
gcaaattctgcaccatctctcatggaggaggaaatgaagcctccttatgagacaccagca
ggaggcagtagtgtgaatgcagatgagtttctcatgccacaagacaagatccctactgta
acccttcaagatttggatccctctgccatgaagctgcaggagttcaacacagaggcgatt
ctgagaagcttgaactgggaacttccagaatcacatcattctgtttctttagacactgac
ttagacttgacttggcttcaaggcgagcgttttcttgcaaacaccggactccagtttcaa
gattacagtagtagcccatcactcctatctgagctcccagcccaccttaattggtatgga
aatgagcggctgcctgaccctgacgagtattccttcatggtagaccaaggtttattcata
tcttaa

DBGET integrated database retrieval system