KEGG   Arabidopsis thaliana (thale cress): AT1G68520Help
Entry
AT1G68520         CDS       T00041                                 

Definition
(RefSeq) zinc finger protein CONSTANS-LIKE 6
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 406 aa AA seqDB search
MMKSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRLK
SASAGKYRHASPPHQATWHQGFTRKARTPRGGKKSHTMVFHDLVPEMSTEDQAESYEVEE
QLIFEVPVMNSMVEEQCFNQSLEKQNEFPMMPLSFKSSDEEDDDNAESCLNGLFPTDMEL
AQFTADVETLLGGGDREFHSIEELGLGEMLKIEKEEVEEEGVVTREVHDQDEGDETSPFE
ISFDYEYTHKTTFDEGEEDEKEDVMKNVMEMGVNEMSGGIKEEKKEKALMLRLDYESVIS
TWGGQGIPWTARVPSEIDLDMVCFPTHTMGESGAEAHHHNHFRGLGLHLGDAGDGGREAR
VSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSIGVAH
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaagtttggctagtgcggttggagggaagacggcgagggcatgtgatagctgc
gtgaagaggcgggcacgttggtattgcgcagctgatgatgcctttctttgccatgcttgt
gacggttcggtccactcggcaaaccctcttgctcgtaggcacgagagagttcgcttgaaa
tcggctagcgccggaaagtatcgccatgcctcgccgcctcaccaagccacgtggcatcag
ggatttacacgtaaagctcggaccccacgtggaggcaagaagagccacacgatggttttt
catgatcttgtgccggagatgagcacggaggatcaagcggagagttacgaggtggaagag
cagctcatatttgaggtgccggtgatgaactcgatggttgaggagcaatgctttaaccaa
tccctggagaaacagaatgagtttccaatgatgcccttaagtttcaagagtagtgacgaa
gaagatgacgacaacgctgagagttgtctgaatggtttgttcccaaccgacatggaacta
gctcagttcacagctgacgtggagactctactcggtggaggggatcgagagtttcattcc
atagaagaactagggttaggtgagatgttaaagatcgaaaaagaggaggtggaggaagag
ggagttgtgacaagagaagtgcatgatcaagatgaaggtgatgagacatccccatttgaa
ataagctttgactacgagtacacacacaagaccacattcgatgaaggagaagaagatgag
aaagaagacgtgatgaagaatgtgatggagatgggagtgaatgagatgagtggtgggatt
aaagaagagaagaaggagaaggctcttatgcttagattggactatgaatcagtcatttcc
acttggggaggccaagggatcccatggaccgcccgggtgccatctgaaatagacctcgac
atggtttgtttcccaacccataccatgggtgaaagtggagcagaggctcatcatcacaac
cacttccgcggcctagggttacacctaggagatgctggggatggaggaagagaggctagg
gtttcaagataccgagagaaaaggaggacaaggttgttctccaagaagataaggtacgag
gtacgtaaattgaatgcagagaaaaggcctcgcatgaaaggaaggttcgtcaagagatct
tcaattggtgttgctcactaa

DBGET integrated database retrieval system