KEGG   Arabidopsis thaliana (thale cress): AT1G69740Help
Entry
AT1G69740         CDS       T00041                                 

Gene name
HEMB1
Definition
putative delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AT1G69740 (HEMB1)
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     AT1G69740 (HEMB1)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT1G69740 (HEMB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 430 aa AA seqDB search
MATTPIFNASCSFPSTRGIDCKSYIGLRSNVSKVSVASSRIATSQRRNLVVRASESGNGH
AKKLGMSDAECEAAVAAGNVPEAPPVPPKPAAPVGTPIIKPLNLSRRPRRNRASPVTRAA
FQETDISPANFVYPLFIHEGEEDTPIGAMPGCYRLGWRHGLVQEVAKARAVGVNSIVLFP
KVPEALKNSTGDEAYNDNGLVPRTIRLLKDKYPDLIIYTDVALDPYSSDGHDGIVREDGV
IMNDETVHQLCKQAVSQARAGADVVSPSDMMDGRVGAIRSALDAEGFQNVSIMSYTAKYA
SSFYGPFREALDSNPRFGDKKTYQMNPANYREALIEAREDEAEGADILLVKPGLPYLDII
RLLRDKSPLPIAAYQVSGEYSMIKAGGVLKMIDEEKVMMESLMCLRRAGADIILTYFALQ
AATCLCGEKR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggctactacacccatctttaatgcttcttgcagctttccttcgactagaggaatcgat
tgcaaaagctatattggtctgagatcgaatgtgagtaaagtgagtgttgcttcttctcgc
attgcaactagtcaacgtcgtaatcttgtcgtaagagctagtgaatccggcaatggacat
gctaagaagcttggaatgagtgatgctgagtgtgaagctgccgttgctgctggaaatgtt
cctgaagctcctccggttccacctaaaccggctgctccggttgggacaccgataattaag
cctcttaatctaagccgacgcccacgtcgtaaccgcgcttcccctgttactagagctgcc
tttcaggaaactgatatctcccctgcaaattttgtatatccacttttcattcatgaaggt
gaggaagacacgcctattggagctatgcccggttgctacagacttggctggaggcatggt
cttgtacaagaggttgcaaaggctcgagctgttggggtaaacagtatcgttttgttccct
aaagttcctgaggctttgaagaattcaacaggggatgaggcatacaatgacaatggtttg
gtgcctcgaacaattcgtcttcttaaagacaaatatcctgatcttattatctacactgat
gtggctttggatccttactcatctgatggtcacgatgggatagttagagaggatggtgta
attatgaatgacgaaacagtacaccagctctgtaaacaagctgtttcccaggctcgagct
ggtgctgacgtagttagtccgagtgacatgatggatgggcgagtaggtgcaatccgctca
gctcttgatgctgaaggatttcaaaacgtctccatcatgtcatacacagccaagtatgca
agttcgttttacggtcctttccgtgaagccctggactcaaacccgcgtttcggagacaag
aaaacgtatcagatgaacccagcaaactacagagaggcattgattgaggcacgtgaagac
gaggctgaaggagcagacattctcctggtgaagccaggtcttccatatttggacatcata
cggcttttgagggacaagtctccattaccgattgctgcataccaagtttctggagagtac
tcgatgatcaaagcagggggagtcctgaaaatgatcgatgaagagaaagtgatgatggag
tcactgatgtgtttacgcagagctggagcggacatcatcctcacgtacttcgctcttcaa
gctgctacttgtttgtgcggcgagaagcggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system