KEGG   Arabidopsis thaliana (thale cress): AT1G69740Help
Entry
AT1G69740         CDS       T00041                                 

Gene name
HEMB1
Definition
putative delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ath00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 430 aa AA seqDB search
MATTPIFNASCSFPSTRGIDCKSYIGLRSNVSKVSVASSRIATSQRRNLVVRASESGNGH
AKKLGMSDAECEAAVAAGNVPEAPPVPPKPAAPVGTPIIKPLNLSRRPRRNRASPVTRAA
FQETDISPANFVYPLFIHEGEEDTPIGAMPGCYRLGWRHGLVQEVAKARAVGVNSIVLFP
KVPEALKNSTGDEAYNDNGLVPRTIRLLKDKYPDLIIYTDVALDPYSSDGHDGIVREDGV
IMNDETVHQLCKQAVSQARAGADVVSPSDMMDGRVGAIRSALDAEGFQNVSIMSYTAKYA
SSFYGPFREALDSNPRFGDKKTYQMNPANYREALIEAREDEAEGADILLVKPGLPYLDII
RLLRDKSPLPIAAYQVSGEYSMIKAGGVLKMIDEEKVMMESLMCLRRAGADIILTYFALQ
AATCLCGEKR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggctactacacccatctttaatgcttcttgcagctttccttcgactagaggaatcgat
tgcaaaagctatattggtctgagatcgaatgtgagtaaagtgagtgttgcttcttctcgc
attgcaactagtcaacgtcgtaatcttgtcgtaagagctagtgaatccggcaatggacat
gctaagaagcttggaatgagtgatgctgagtgtgaagctgccgttgctgctggaaatgtt
cctgaagctcctccggttccacctaaaccggctgctccggttgggacaccgataattaag
cctcttaatctaagccgacgcccacgtcgtaaccgcgcttcccctgttactagagctgcc
tttcaggaaactgatatctcccctgcaaattttgtatatccacttttcattcatgaaggt
gaggaagacacgcctattggagctatgcccggttgctacagacttggctggaggcatggt
cttgtacaagaggttgcaaaggctcgagctgttggggtaaacagtatcgttttgttccct
aaagttcctgaggctttgaagaattcaacaggggatgaggcatacaatgacaatggtttg
gtgcctcgaacaattcgtcttcttaaagacaaatatcctgatcttattatctacactgat
gtggctttggatccttactcatctgatggtcacgatgggatagttagagaggatggtgta
attatgaatgacgaaacagtacaccagctctgtaaacaagctgtttcccaggctcgagct
ggtgctgacgtagttagtccgagtgacatgatggatgggcgagtaggtgcaatccgctca
gctcttgatgctgaaggatttcaaaacgtctccatcatgtcatacacagccaagtatgca
agttcgttttacggtcctttccgtgaagccctggactcaaacccgcgtttcggagacaag
aaaacgtatcagatgaacccagcaaactacagagaggcattgattgaggcacgtgaagac
gaggctgaaggagcagacattctcctggtgaagccaggtcttccatatttggacatcata
cggcttttgagggacaagtctccattaccgattgctgcataccaagtttctggagagtac
tcgatgatcaaagcagggggagtcctgaaaatgatcgatgaagagaaagtgatgatggag
tcactgatgtgtttacgcagagctggagcggacatcatcctcacgtacttcgctcttcaa
gctgctacttgtttgtgcggcgagaagcggtag

DBGET integrated database retrieval system