KEGG   Arabidopsis thaliana (thale cress): AT1G69940Help
Entry
AT1G69940         CDS       T00041                                 

Gene name
PPME1
Definition
(RefSeq) Pectin lyase-like superfamily protein
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00040  Pentose and glucuronate interconversions
ath01100  Metabolic pathways
Module
ath_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AT1G69940 (PPME1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     AT1G69940 (PPME1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase DUF1565 PsbL
Motif
Other DBs
NCBI-GeneID: 843331
NCBI-ProteinID: NP_177152
MIPS: AT1G69940.1
TAIR: AT1G69940
Araport: AT1G69940
UniProt: Q84WM7
Position
1
AA seq 361 aa AA seqDB search
MGYTNVSILLGLLMVFVTPMVFADDVTPIPEGKPQVAQWFNANVGPLAQRKGLDPALVAA
EAAPRIINVNPKGGEFKTLTDAIKSVPAGNTKRVIIKMAPGEYKEKVTIDRNKPFITLMG
QPNAMPVITYDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRI
SGNFAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVVGDGI
RVIAAHAGKSAEEKSGYSFVHCKVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQ
ENKTPAHDKTVFYGEYKCSGPGSHKAKRVPFTQDIDDKEANRFLSLGYIQGSKWLLPPPA
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgggatacacaaatgtgtccattttattaggcctgttgatggtctttgttacaccgatg
gtgttcgcagatgatgtgacaccaatcccagagggcaaaccccaagtggcgcagtggttc
aatgccaacgttggtccattggctcaacgtaaaggcttagatcctgctcttgtagctgct
gaggctgctccacgtatcatcaacgtgaatccaaagggtggtgaattcaaaacactaacg
gacgcaataaagagcgttcctgcagggaacacaaagcgggtgatcataaagatggctcct
ggtgaatacaaagagaaggtcactatcgacaggaacaaacccttcattacattgatggga
caacccaatgccatgcctgttatcacctatgacggtaccgccgccaagtatggaaccgtt
gatagcgcctctctcattatcttatccgactatttcatggccgttaacatcgtcgttaag
aacactgcgccggcaccagatggtaaaactaagggagcacaagctttatccatgagaatc
tccggaaattttgctgctttctacaactgcaaattctacggtttccaagacacaatctgt
gacgatacaggaaaccatttcttcaaggattgttacgttgaaggaacattcgatttcatc
ttcggaagtggaacctctatgtacttgggaacacaattgcacgtggttggagacggtatt
agagtgatagcagcgcatgcaggaaagagcgcagaagagaagagtggatactctttcgtg
cactgcaaggtgactggaaccggtggaggaatttatttgggaagagcatggatgagccac
cctaaggttgtttatgcctacaccgagatgaccagcgttgtcaaccccaccggatggcaa
gaaaacaagactcccgcacatgacaaaaccgtgttctacggagagtacaagtgttcagga
ccaggatcacacaaagccaagagagtaccattcacacaagacattgacgacaaagaagct
aaccgtttcctatccctcggctacatccaaggatccaagtggcttctcccaccacccgct
ttgtaa

DBGET integrated database retrieval system