KEGG   Arabidopsis thaliana (thale cress): AT1G70610Help
Entry
AT1G70610         CDS       T00041                                 

Gene name
ABCB26
Definition
(RefSeq) transporter associated with antigen processing protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
1
AA seq 700 aa AA seqDB search
MAQQVLGCTSRPIRVSLHRCSVITTSDTIRRKNLRFVRNPRLSFSLQSSTRNYRLPSINC
STVNGAVAETAEYYEGEGDNVSLAEKIRQCIDFLRTILPGGSWWSFSDEVDGRFIAKPVT
VWRALSRMWELVAEDRWVIFAAFSTLIVAALSEITIPHFLTASIFSAQSGDIAVFHRNVK
LLVTLCVTSGICSGIRGCFFGIANMILVKRMRETLYSTLLFQDISFFDSQTVGDLTSRLG
SDCQQVSRVIGNDLNMIFRNVLQGTGALIYLLILSWPLGLCTLVICCILAAVMFVYGMYQ
KKTAKLIQEITASANEVAQETYSLMRTVRVYGTEKQEFKRYNHWLQRLADISLRQSAAYG
IWNWSFNTLYHATQIIAVLVGGLSILAGQITAEQLTKFLLYSEWLIYATWWVGDNLSSLM
QSVGASEKVFQMMDLKPSDQFISKGTRLQRLTGHIEFVDVSFSYPSRDEVAVVQNVNISV
HPGEVVAIVGLSGSGKSTLVNLLLQLYEPTSGQILLDGVPLKELDVKWLRQRIGYVGQEP
KLFRTDISSNIKYGCDRNISQEDIISAAKQAYAHDFITALPNGYNTIVDDDLLSGGQKQR
IAIARAILRDPRILILDEATSALDAESEHNVKGVLRSIGNDSATKRSVIVIAHRLSTIQA
ADRIVAMDSGRVVEMGSHKELLSKDGLYARLTKRQNDAVL
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcaagtactcggctgcacgagccgccccatccgcgtttctcttcaccggtgt
tctgttattaccaccagtgacactatcagaaggaagaatctccgattcgttagaaacccg
agattgtcgttttctcttcaatcttcaactagaaattatcgtctgccttcgattaattgc
tcgacggtgaatggagcagtagcggaaactgcggaatattacgaaggagaaggagataac
gtttcacttgctgagaaaatccggcaatgtattgatttcctccggacgattttaccaggt
ggaagctggtggagtttctccgatgaagttgatggtaggttcattgctaagcctgtgact
gtttggcgtgcgttaagtcggatgtgggaacttgtggctgaggatcgttgggttatcttc
gctgcgttttccactcttatagtagccgcgctttcagagataactattccgcatttttta
acagcttcgatcttctcggcacaaagtggtgatatcgctgtgtttcatcgaaatgtcaag
ctcttggttacgttatgtgttacttcaggcatttgcagtggcatacgaggatgcttcttt
gggattgctaacatgatacttgtgaaacgaatgagggaaacactatactccactcttctc
ttccaggatatatcatttttcgactctcaaactgttggtgacttaacaagcagacttggc
tcagactgtcagcaagtctcgagggtcatcggaaatgatctgaacatgatatttcgcaat
gttcttcagggtacaggggcattgatttatttgctaattttgtcttggccccttgggctg
tgcacattggtgatatgctgtattttggctgcggttatgttcgtttatgggatgtaccaa
aagaagacagcgaagctaattcaggagatcacagcttctgcaaatgaagtcgctcaagag
acatactctttgatgagaaccgttcgtgtatatgggacagagaagcaagagtttaaaagg
tacaatcactggcttcagagattggcggatataagtttgagacagagtgctgcatatggt
atttggaactggagcttcaacactctataccatgcaactcagattattgctgtcctggtt
ggaggattgtctatcttagctggtcaaataacagcagagcagctgacaaagtttctgttg
tatagtgagtggttaatctatgctacatggtgggtgggagataatttatcatctttgatg
caatcggttggagcaagtgaaaaggttttccaaatgatggatctcaagccaagtgatcaa
ttcatatcaaaaggaacgagactgcagagactgacaggacatatcgagtttgtagatgtg
tcatttagctacccttcaagagatgaggtagcggtggttcaaaacgtaaacatttccgtg
catcctggtgaagtggtagcaatcgttggtctaagtggcagtggcaaaagtacactggtt
aatcttttgctgcaactctacgaaccaacaagtggtcagattctactagatggggttcct
ttgaaagagttggatgtcaagtggcttaggcaaagaatcggatacgtggggcaggaacca
aagctcttccgcacagacatcagttcgaacatcaagtacggatgtgatcgtaatatatcg
caagaagatataatatcggctgcaaagcaagcctatgcacatgactttatcacagcactt
ccgaatggttacaacacaattgttgatgatgatctactcagtggagggcagaaacaacgg
attgccattgctcgtgccatccttagagatcctagaatcctcatcctcgatgaagccaca
agtgcactcgatgcagagagcgaacacaatgttaagggcgtacttcgttctatcggaaac
gactcagcaacaaagagaagcgtcatagtgatagcacacagactttctacaattcaagct
gcggatagaatagtggctatggacagtggacgagtcgtcgagatgggcagtcacaaagaa
cttttgagcaaagatggcttatacgcgagattgacgaagagacaaaacgatgccgtctta
tga

DBGET integrated database retrieval system