KEGG   Arabidopsis thaliana (thale cress): AT1G71260Help
Entry
AT1G71260         CDS       T00041                                 

Gene name
ATWHY2
Definition
(RefSeq) single-stranded DNA-binding protein WHY2
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
1
AA seq 238 aa AA seqDB search
MMKQARSLLSRSLCDQSKSLFEASTLRGFASWSNSSTPGRGFPGKDAAKPSGRLFAPYSI
FKGKAALSVEPVLPSFTEIDSGNLRIDRRGSLMMTFMPAIGERKYDWEKKQKFALSPTEV
GSLISMGSKDSSEFFHDPSMKSSNAGQVRKSLSVKPHADGSGYFISLSVNNSILKTNDYF
VVPVTKAEFAVMKTAFSFALPHIMGWNRLTGHVNTEALPSRNVSHLKTEPQLELEWDK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcaagcccgctctttgctctccaggagcctttgtgaccaaagtaagtcactt
ttcgaagcttcgacgttgcgtggttttgcaagctggtcaaattcttcaacccctggacgt
ggattccctggtaaagatgccgcaaagcctagtggtcgattgttcgcaccttattctatc
ttcaaaggaaaagctgctctctctgttgaacctgttcttcccagtttcactgaaatcgat
tcgggaaatcttcggatagatcgtcgtggatccttaatgatgacttttatgcctgctatt
ggtgagcgtaagtacgactgggaaaagaaacagaaatttgctttgtcacctactgaagtt
ggatccttaattagcatgggttccaaagacagctccgagtttttccatgacccttccatg
aaatcaagtaatgctggtcaagtcaggaagtcactgtcagttaagccccacgcagatggt
agcggctacttcatctcattgagcgttaacaatagcatcctcaaaaccaatgactatttt
gtggttcctgtcacaaaagctgaatttgcagtgatgaagacagcttttagttttgctctt
ccacacatcatgggttggaatcggttaactggtcacgttaatactgaagctctgccgtcg
aggaatgtttctcatctaaagactgaaccacagttagagctggagtgggataaatga

DBGET integrated database retrieval system