KEGG   Arabidopsis thaliana (thale cress): AT1G72810Help
Entry
AT1G72810         CDS       T00041                                 

Definition
threonine synthase 2
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AT1G72810
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT1G72810
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AT1G72810
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AT1G72810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 516 aa AA seqDB search
MASFSLPHSATYFPSHSETSLKPHSAASFTVRCTSASPAVPPQTPQKPRRSPDENIRDEA
RRRPHQLQNLSARYVPFNAPPSSTESYSLDEIVYRSQSGALLDVQHDFAALKRYDGEFWR
NLFDSRVGKTNWPYGSGVWSKKEWVLPEIDDDDIVSAFEGNSNLFWAERFGKQYLQMNDL
WVKHCGISHTGSFKDLGMSVLVSQVNRLRKMNKPVIGVGCASTGDTSAALSAYCASAGIP
SIVFLPADKISMAQLVQPIANGAFVLSIDTDFDGCMHLIREVTAELPIYLANSLNSLRLE
GQKTAAIEILQQFNWQVPDWVIVPGGNLGNIYAFYKGFHMCKELGLVDRIPRLVCAQAAN
ANPLYLHYKSGFKEDFNPLKANTTFASAIQIGDPVSIDRAVYALKKSNGIVEEATEEELM
DATALADSTGMFICPHTGVALTALMKLRKSGVIGANDRTVVVSTAHGLKFTQSKIDYHSK
NIKEMACRLANPPVKVKAKFGSVMDVLKEYLKSNDK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcctcattctctcttccccactccgccacctactttccttcccactctgaaacctca
cttaaacctcactccgccgcttccttcaccgtccgttgcacctccgcctctcccgccgtt
cctccacagactccacagaaaccccgtcgttcacccgatgagaacattcgagacgaagct
cgtcgccgtcctcatcaactccaaaacctctccgcacgttacgtccctttcaacgctcca
ccttcttcaacagaatcctactccctcgacgagatcgtctaccgttcacaatccggtgct
ctcctcgacgtccagcatgatttcgccgccttgaaacgctacgacggagaattctggcgt
aaccttttcgattctcgcgtcggtaaaacaaattggccgtacggatcaggcgtgtggtcg
aagaaagagtgggtactccccgagatcgacgatgacgacatcgtctctgcttttgaagga
aactcaaatctcttctgggctgagagatttggtaaacagtatctgcaaatgaacgatctt
tgggtgaaacattgtggaatcagccacactggctcctttaaagatctgggcatgagtgtt
ctcgtttctcaggtgaatcgtctccggaaaatgaacaaaccagtcatcggagttggttgc
gcttctactggagatacctccgctgctctctctgcttactgtgcttccgctggaatcccc
tcgattgtcttcttacctgcggataaaatctccatggctcagcttgtgcagccgattgca
aacggagcgtttgtgcttagtattgacactgattttgacggatgtatgcatttgatcaga
gaagttacggcggagcttcctatttacttggcgaactctctcaacagcctccgtctcgaa
ggtcaaaagacggcggcgattgagattctgcagcagtttaattggcaagttcctgattgg
gtcattgttcctggaggcaatcttggtaacatctatgcgttttacaaagggtttcatatg
tgtaaagagttaggtcttgttgatcgtatccctaggcttgtttgtgctcaagctgctaat
gcaaatccactttacttgcattacaaatctgggtttaaagaagatttcaatccattgaaa
gcaaacactacatttgcttctgctattcagattggtgaccctgtttcgattgatagagct
gtgtatgcgttgaagaaatctaatgggattgttgaggaagctacagaggaagagttgatg
gatgcaacagctcttgctgattctactggtatgtttatatgtccacatactggtgttgca
ttgacggcgttgatgaagctgagaaagtcaggagttattggagcgaatgatcggactgtg
gtggtgagtacagctcatggattgaagtttacacaaagtaagattgattatcattctaag
aacataaaggagatggcttgtagattggcgaatccaccagtgaaggttaaggcaaagttt
ggttcagttatggatgttctcaaggagtatttgaagagcaatgataaataa

DBGET integrated database retrieval system