KEGG   Arabidopsis thaliana (thale cress): AT1G72990Help
Entry
AT1G72990         CDS       T00041                                 

Gene name
BGAL17
Definition
beta-galactosidase 17
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ath00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ath00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:ath00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:ath00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ath00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 635 aa AA seqDB search
MTISGKMGIVFRSLVVICITFVFFQRLWMQYWEDRLLRANALGLNTIQVYVPWNLHEPKP
GKMVFEGIGDLVSFLKLCEKLDFLVMLRAGPYICGEWDLGGFPAWLLAVKPRLQLRTSDP
VYLKLVERWWDVLLPKVFPLLYSNGGPVIMVQIENEYGSYGNDKAYLRKLVSMARGHLGD
DIIVYTTDGGTKETLDKGTVPVADVYSAVDFSTGDDPWPIFKLQKKFNAPGRSPPLSSEF
YTGWLTHWGEKITKTDAEFTAASLEKILSRNGSAVLYMVHGGTNFGFYNGANTGSEESDY
KPDLTSYDYDAPIKESGDIDNPKFQALQRVIKKYNASPHPISPSNKQRKAYGSIKMQMTT
SLFDLVRMTDPADVITSANPISMESVGQMFGFLLYESSYIAKKSGNTLRIPKVHDRAQVF
VSCLSQDVDVGVLRYIGTTERWNNQPISLPTIECTTNTSLFILVENMGRVNYGPYIFDDK
GILSSVYLDGQILHGWKMIPIPFHNLNQEPNLTFEMQHTKNRSKKFELTNDVGRKEPALF
AGEFSINSEEEIKDTYLSFNGWGKGVAFVNEFNIGRYWPSVGPQCNLYVPAPLLKRGKNT
LVVFELESPHLELSLEAVDHQDFTCGSNVSKVNQL
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgacaatttctggaaagatgggaatcgttttcagatcattggtggtgatttgcattact
ttcgtgttcttccagagattatggatgcagtactgggaggatcggcttttaagagccaat
gctttaggcttgaatactattcaagtatacgttccttggaatctgcatgaaccaaagcct
gggaagatggtttttgagggtattggtgatcttgtctcctttctcaagctgtgtgagaaa
ctagattttctggttatgctacgtgctggaccttatatctgtggagaatgggatttggga
ggctttcctgcttggttacttgctgtgaaaccacgtctccaactaaggacatcagatcct
gtatatcttaagttggttgaaagatggtgggatgttctgttaccgaaggtatttcctctg
ctttacagcaacgggggtcctgttataatggttcagattgaaaatgaatatggttcatat
ggaaatgacaaagcttatcttcgtaagctagttagtatggctaggggacacctgggggat
gacattattgtgtacacaacagatggagggacaaaagaaactcttgataaaggaactgtc
cctgtagctgatgtctactcagctgttgatttctctaccggtgatgatccttggccaata
tttaaattgcaaaagaagtttaatgctccaggaagatcacctccactttcctcggagttc
tacactggttggctcacgcattggggtgagaaaattacaaaaacagatgccgaatttacg
gcagcttctcttgaaaaaattctgtctcgaaatggttctgctgtgctctatatggtgcat
ggaggaacaaactttggtttctacaatggcgcaaatactggctctgaagaatctgactat
aaaccagatctgacatcttatgactatgatgctcccattaaggagtctggtgacatagat
aatccaaaattccaagctcttcagagagtgattaagaagtacaatgcttcaccacacccc
attagcccatccaataagcaacggaaagcttatggctctatcaagatgcagatgacaaca
tcactgtttgatttagttcgtatgacagatcctgcagatgtgatcacctccgccaaccca
atttcaatggaatctgttggacagatgttcggatttcttttatatgaatcttcatacatc
gcaaaaaagagtgggaatacactaagaatacccaaggttcatgacagagctcaagtgttt
gtttcatgtctttcccaagatgttgatgtgggagtactgagatacattggtactactgag
agatggaacaaccaacctatttctcttccaactattgagtgtaccacaaacactagctta
tttattctggttgaaaacatgggtcgtgtaaattatgggccatatatctttgatgacaag
ggtattttgtcttcggtttatctagatggtcaaattctccatggatggaagatgatacca
attccttttcacaatctaaatcaagagccaaatctcactttcgagatgcaacataccaaa
aacagaagtaaaaagttcgagcttactaatgatgttggtcgaaaggaacccgctctgttt
gctggtgaattctctatcaacagtgaagaagaaatcaaagacacatatctatcattcaac
ggttggggtaaaggagttgcttttgtcaatgaattcaacattggaagatattggccgtct
gttggaccacagtgcaacctctatgttcctgcgccacttcttaagcgtggcaaaaacact
ttggtggtattcgagttggaatctccgcatctcgagctttcgctggaggcagtggatcac
caagacttcacatgcggttcaaatgtttccaaagttaatcagttgtag

DBGET integrated database retrieval system