KEGG   Arabidopsis thaliana (thale cress): AT1G72990Help
Entry
AT1G72990         CDS       T00041                                 

Gene name
BGAL17
Definition
beta-galactosidase 17
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AT1G72990 (BGAL17)
  Lipid metabolism
   00600 Sphingolipid metabolism
    AT1G72990 (BGAL17)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    AT1G72990 (BGAL17)
   00604 Glycosphingolipid biosynthesis - ganglio series
    AT1G72990 (BGAL17)
   00511 Other glycan degradation
    AT1G72990 (BGAL17)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AT1G72990 (BGAL17)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT1G72990 (BGAL17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 635 aa AA seqDB search
MTISGKMGIVFRSLVVICITFVFFQRLWMQYWEDRLLRANALGLNTIQVYVPWNLHEPKP
GKMVFEGIGDLVSFLKLCEKLDFLVMLRAGPYICGEWDLGGFPAWLLAVKPRLQLRTSDP
VYLKLVERWWDVLLPKVFPLLYSNGGPVIMVQIENEYGSYGNDKAYLRKLVSMARGHLGD
DIIVYTTDGGTKETLDKGTVPVADVYSAVDFSTGDDPWPIFKLQKKFNAPGRSPPLSSEF
YTGWLTHWGEKITKTDAEFTAASLEKILSRNGSAVLYMVHGGTNFGFYNGANTGSEESDY
KPDLTSYDYDAPIKESGDIDNPKFQALQRVIKKYNASPHPISPSNKQRKAYGSIKMQMTT
SLFDLVRMTDPADVITSANPISMESVGQMFGFLLYESSYIAKKSGNTLRIPKVHDRAQVF
VSCLSQDVDVGVLRYIGTTERWNNQPISLPTIECTTNTSLFILVENMGRVNYGPYIFDDK
GILSSVYLDGQILHGWKMIPIPFHNLNQEPNLTFEMQHTKNRSKKFELTNDVGRKEPALF
AGEFSINSEEEIKDTYLSFNGWGKGVAFVNEFNIGRYWPSVGPQCNLYVPAPLLKRGKNT
LVVFELESPHLELSLEAVDHQDFTCGSNVSKVNQL
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgacaatttctggaaagatgggaatcgttttcagatcattggtggtgatttgcattact
ttcgtgttcttccagagattatggatgcagtactgggaggatcggcttttaagagccaat
gctttaggcttgaatactattcaagtatacgttccttggaatctgcatgaaccaaagcct
gggaagatggtttttgagggtattggtgatcttgtctcctttctcaagctgtgtgagaaa
ctagattttctggttatgctacgtgctggaccttatatctgtggagaatgggatttggga
ggctttcctgcttggttacttgctgtgaaaccacgtctccaactaaggacatcagatcct
gtatatcttaagttggttgaaagatggtgggatgttctgttaccgaaggtatttcctctg
ctttacagcaacgggggtcctgttataatggttcagattgaaaatgaatatggttcatat
ggaaatgacaaagcttatcttcgtaagctagttagtatggctaggggacacctgggggat
gacattattgtgtacacaacagatggagggacaaaagaaactcttgataaaggaactgtc
cctgtagctgatgtctactcagctgttgatttctctaccggtgatgatccttggccaata
tttaaattgcaaaagaagtttaatgctccaggaagatcacctccactttcctcggagttc
tacactggttggctcacgcattggggtgagaaaattacaaaaacagatgccgaatttacg
gcagcttctcttgaaaaaattctgtctcgaaatggttctgctgtgctctatatggtgcat
ggaggaacaaactttggtttctacaatggcgcaaatactggctctgaagaatctgactat
aaaccagatctgacatcttatgactatgatgctcccattaaggagtctggtgacatagat
aatccaaaattccaagctcttcagagagtgattaagaagtacaatgcttcaccacacccc
attagcccatccaataagcaacggaaagcttatggctctatcaagatgcagatgacaaca
tcactgtttgatttagttcgtatgacagatcctgcagatgtgatcacctccgccaaccca
atttcaatggaatctgttggacagatgttcggatttcttttatatgaatcttcatacatc
gcaaaaaagagtgggaatacactaagaatacccaaggttcatgacagagctcaagtgttt
gtttcatgtctttcccaagatgttgatgtgggagtactgagatacattggtactactgag
agatggaacaaccaacctatttctcttccaactattgagtgtaccacaaacactagctta
tttattctggttgaaaacatgggtcgtgtaaattatgggccatatatctttgatgacaag
ggtattttgtcttcggtttatctagatggtcaaattctccatggatggaagatgatacca
attccttttcacaatctaaatcaagagccaaatctcactttcgagatgcaacataccaaa
aacagaagtaaaaagttcgagcttactaatgatgttggtcgaaaggaacccgctctgttt
gctggtgaattctctatcaacagtgaagaagaaatcaaagacacatatctatcattcaac
ggttggggtaaaggagttgcttttgtcaatgaattcaacattggaagatattggccgtct
gttggaccacagtgcaacctctatgttcctgcgccacttcttaagcgtggcaaaaacact
ttggtggtattcgagttggaatctccgcatctcgagctttcgctggaggcagtggatcac
caagacttcacatgcggttcaaatgtttccaaagttaatcagttgtag

DBGET integrated database retrieval system