KEGG   Arabidopsis thaliana (thale cress): AT1G73050Help
Entry
AT1G73050         CDS       T00041                                 

Definition
Glucose-methanol-choline (GMC) oxidoreductase family protein
Orthology
K08248  
mandelonitrile lyase [EC:4.1.2.10]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Cyanoamino acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AT1G73050
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.10  (R)-mandelonitrile lyase
     AT1G73050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 552 aa AA seqDB search
MTKRIDSSLLYTALVVLLLLGVVHRSNARPRVNRPPGFMRFISNATDFASEDYYDYIIVG
GGTAGCPLAATLSQSFRVLLLERGGVPYNRPNVMSHDGFLTTLTDVNNFDSPAQSFISEE
GVPNARGRVLGGSSAINAGFYSRADKQFFENSGLVWDLSSVNQSYEWVERAIVFRPQLRT
WQTAIRDALLEVGVHPFNGFTLEHKVGTKIGGSTFDRTGRRHSSADLLRYARSSNIRVAV
YATVERVLLASSPSVSGSNVSAIGVVYRDQLGRFHHALIRDRGEVILSAGALGSPQLLFL
SGIGPRSYLSTWGIPVALDQPHVGDFVYDNPRNGISIVPPVPMENSLIQVVGVTEDGAFL
EAASNVIPFASPLHSVFIRAPASPLYVPVTTIMEKILGPVSIGLLRLASTDVRINPVVRF
NYFSDPQDLERCVNGTRKIGEILRSRAMQDFMIREWFGNRRFRFVGAPLPVDQSNDLVMA
DFCRRTVSTIWHYHGGAVVGKVVDSDLKVIGVNSLRLVDGSTFNISPGTNPQATLMMLGR
YMGLKMLRERMR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaacggattgattcttctcttctctacacggcgctcgtagtgcttcttcttctt
ggagtagttcatcgctctaatgcaaggccacgcgttaatcgacctcccggtttcatgcga
ttcatatcgaacgcaactgattttgcgtcggaggattactacgattacataatcgtcgga
ggaggaacggcgggatgtccactagccgccacactttcgcaatctttccgagttcttctg
ctagaacgcggtggcgttccctacaacagacctaacgtgatgtcacacgacggtttcttg
accactctcactgacgtcaacaatttcgactcgccggctcagtctttcatctctgaggaa
ggagttcctaacgcgagaggtcgtgttcttggaggaagtagtgcgatcaatgctggattc
tatagccgtgctgataaacagttctttgagaattcgggtcttgtttgggatctgagtagt
gtgaatcagtcttatgagtgggttgagagagcgattgtgtttagacctcagctcaggact
tggcaaactgcaattagggatgcgttgcttgaagttggtgtccatccgtttaatggcttc
accttggagcataaagtggggactaagatcggaggttccacgtttgatcgtactgggagg
agacacagctctgcagatcttctcagatatgcaaggagttccaacattagagttgcagtt
tacgcaactgtagagagagtattgcttgcttcatctcctagtgtctcaggttccaacgtt
tctgcgattggagtggtttaccgtgatcagctgggacgtttccatcacgcattgatacgg
gacagaggagaggtgatactgtctgctggtgcactcggtagcccacagttgctttttctt
agtgggattggtccaaggagttatctttcaacttgggggatccctgtggctcttgaccag
cctcatgtgggggattttgtgtatgataacccgaggaatggtatctccattgttcctccg
gttccaatggagaactcactgatacaagtcgtgggtgttactgaggatggggcttttctg
gaggctgcttcgaatgtgattccgtttgcatcgcctttacattctgtgttcatcagagct
ccagcttctcctttgtacgtccctgtgacaactataatggaaaagatcctaggtccagtg
tctattggtttactaaggttggcgtcaacggatgtgaggattaacccagttgttagattc
aactacttcagtgatccacaggatctagagagatgtgtcaatgggactaggaagattgga
gaaatactcaggagccgagctatgcaggactttatgataagggaatggtttgggaaccgt
aggttcaggtttgttggagctccattgcctgtggaccaatcaaatgatcttgtgatggca
gatttctgcagacgaactgtgagcacaatctggcactaccatggaggcgctgttgtagga
aaagtagtggactctgatctcaaagtcattggtgttaattctcttagactcgtggatgga
tcaaccttcaatatctctccagggactaatcctcaggctaccttgatgatgcttggaagg
tacatggggctgaagatgctgagagagaggatgagatag

DBGET integrated database retrieval system