KEGG   Arabidopsis thaliana (thale cress): AT1G73220Help
Entry
AT1G73220         CDS       T00041                                 

Gene name
1-Oct
Definition
(RefSeq) organic cation/carnitine transporter1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 539 aa AA seqDB search
MEPSKQEVPKLMETPPNISNDSSATEKGEATRQQQLPNNRYALTVDEVIEQHIGALGFAQ
ILHALLVSIAWIFDAQTTLISIFSDAQPAARLLATGAIVEGASLCGLASGEWEWIGPKSD
TVVSEWNLICQHKFLVAVPSTLFFIGSLFGSGVYGYLADSWFGRKKTLLLSCVLTFVTAF
AISFSPNVWVYAFLRFANGFFRSGIGSCCIVLATEIVGKKWRGQVGQYGFFFFTLGFLSL
PLMAYLERKSWRNLYRIISFLPLGYAVCLLPFAYESPRWLLVKGRNKEAMVVLKKLARLN
GKQLPADLSLVDPIPERDDQTSSSEKFWKTKWAVKRIIMVMMAGFGSGFVYYGIQLNAEN
LNFNLYLTVAVNALMEFPAVFIGSFLLGVMNRRPLFSNSSYLAGFACLLCAVLSIHRVIR
AISVAKWLQLAVEAVGFMASSTAYDVLYVYCVELFPTNVRNTAVSLLRQAFMLGASAAPL
LVALGRESAMMSFIVFGVASVLSGIVSLWLRETRNAPLYETLAQQGKAEEIENETIMIT
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggaaccttcaaaacaagaagttccaaagctcatggagacaccaccgaacatatcaaac
gattcatcagcaaccgagaaaggagaagcaacaaggcaacaacagctaccaaacaatagg
tacgcactcacagttgacgaggtgatcgagcaacacattggagcacttgggtttgctcag
atcttgcatgctctcttggtctctatcgcttggatcttcgatgctcagaccactcttata
tccattttctccgatgctcagcccgcggcgaggcttcttgcaaccggtgccatcgtggag
ggtgcctccttgtgtggattggccagtggagaatgggaatggattggaccaaagagtgac
actgttgtttctgagtggaatctcatatgtcaacataaatttcttgtggctgttccttcc
acactattcttcatcggatctcttttcggttctggtgtgtatggatatcttgctgattca
tggtttggtcgaaagaagactttattactctcttgtgtattaactttcgtcacggccttt
gcgatctctttttcaccaaacgtttgggtttatgcattcttgcgttttgccaacggtttc
tttagatcaggaattgggtcttgttgtatcgtactcgcaactgagattgttggcaaaaag
tggcgaggccaagtagggcaatacggtttcttcttcttcacgttaggttttctatctcta
ccactcatggcttacttggagagaaagtcctggagaaatctttaccggatcatatccttt
cttcctcttggatacgcggtttgtctcctgccctttgcttatgagtctcctcgatggctt
cttgtcaagggacgtaataaagaagccatggtggtcttgaagaaactcgcgaggctcaac
gggaaacaacttccggcggatctaagcctagtcgatccaattccagagagagatgatcaa
acttcatcatcggagaagttttggaaaacaaaatgggcagtgaaaagaatcataatggtt
atgatggctggatttggcagtggctttgtttattatggaattcaactaaatgctgaaaat
ctcaacttcaatctttacttaactgttgctgttaacgctctgatggagtttccagcggtt
ttcatcggaagcttcctcctcggggtcatgaaccgccgtccactattctcgaattcatca
tacctcgccggattcgcgtgtctgctctgcgcggttctctcgatccaccgcgtgatccgt
gcgatatctgtggcaaaatggttacaacttgcagttgaggcggttgggttcatggcatcc
tcgacagcgtatgacgtcctatatgtctactgcgtagagctgttcccaacaaacgttagg
aacactgctgtctcacttttgcgtcaagcgtttatgctaggagcgtctgcagcaccactg
ctagttgcgttaggaagggaaagcgcaatgatgtcgttcatcgtgtttggtgttgcatca
gtgctgagcggcatcgtgagtctctggctacgagaaactcgaaacgctccgctttacgaa
acactagcacaacaggggaaagcggaagagatcgaaaacgaaacaatcatgattacttga

DBGET integrated database retrieval system