KEGG   Arabidopsis thaliana (thale cress): AT1G74020Help
Entry
AT1G74020         CDS       T00041                                 

Gene name
SS2
Definition
(RefSeq) strictosidine synthase 2
  KO
K01757  
strictosidine synthase [EC:4.3.3.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Indole alkaloid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    AT1G74020 (SS2)
Enzymes [BR:ath01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.2  strictosidine synthase
     AT1G74020 (SS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
1
AA seq 335 aa AA seqDB search
MTSFCSMISLLLLLSLSSAVFSDDASFQKLPVPETRSGPEAFAFDSTGKGFYTGVSGGKI
LKYLPETGYVDFAQITESSNSSWCDGTIGTALAGRCGRPAGIAFNEKTGDLYVADAPLGL
HVISPAGGLATKITDSVDGKPFKFLDGLDVDPTTGVVYFTSFSSRFSPIQVLIALGLKDA
TGKLYKYDPSTKVVTVLMEGLSGSAGCAVSSDGSFVLVSQFTKSNIKRYWIKGPKAGSSE
DFTNSVSNPDNIKRIGSTGNFWVASVVNKIIVPTNPSAVKVNSNGEVLQTIPLKDKFGDT
LLSEVNEFEGNLYIGTLTGPFAGILKLEKGSCPAT
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgttttgctccatgatttctcttcttcttcttctctctctttcatcggcggtt
ttctccgatgacgcttctttccagaaacttccggtgccggaaactaggtcaggtcccgaa
gctttcgcttttgattccaccggtaaagggttctataccggtgtctccggtggtaaaatc
ctcaagtacctccccgagacgggttatgttgactttgcccagatcactgaatcctcgaac
tcttcatggtgcgatggtactattggaacggctttagccggacgctgtggtcgaccagca
ggaatagcattcaacgagaaaacaggtgatctttacgtcgccgatgctccgttgggtctt
cacgttatttctcccgccggtggtttggctacgaagatcaccgacagtgttgacggaaag
cctttcaagtttcttgacggtcttgacgttgatcccactactggtgtcgtctacttcact
tccttcagctcacgcttctccccaatccaagtgttgattgcattggggttaaaggacgcg
accggaaagctctacaaatacgacccatcgaccaaagtcgtgactgtactgatggaaggg
ctaagtggttcagccgggtgtgcagtgagctcagatggttcgtttgtgctggttagtcag
ttcacaaaaagtaacatcaagaggtattggatcaagggacccaaagctggttcttctgaa
gacttcaccaactcagtctcaaaccctgacaatatcaaaagaattggctctactggaaac
ttttgggtcgcttcagtggtgaacaagatcatcgtacctacgaacccatcagcagtcaaa
gttaactctaatggtgaagttcttcaaacaattcctctcaaagataaatttggagacact
ctgctcagcgaagtcaacgaattcgagggcaatttatatataggaactctcaccggacca
tttgctggaattcttaagctcgaaaagggttcttgtcctgccacttag

DBGET integrated database retrieval system